Recombinant Mouse Cathepsin D, CSTD (C-6His)

Contact us
Catalog number: CC21
Price: 624 €
Supplier: adv
Product name: Recombinant Mouse Cathepsin D, CSTD (C-6His)
Quantity: 10μg
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Cathepsin D is produced by our Mammalian expression system and the target gene encoding Ile21-Leu410 is expressed with a 6His tag at the C-terminus
Molecular Weight: 43, 9 kD
UniProt number: P18242
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM MES, 5, Lyophilized from a 0, pH5
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: This cathepsin is supplied in 1, CTS protease activity also measured by zymograph electrophoresis of Cathepsins | More about : This cathepsin is supplied in 1, CTS protease activity also measured by zymograph electrophoresis of Cathepsins
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CSTD (C-6His), Cathepsin D
Short name: CSTD (C-6His), Recombinant Mouse Cathepsin D
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CSTD (C-6His), recombinant Mouse Cathepsin D
Alternative technique: rec

Related Products :

CC21 Recombinant Mouse Cathepsin D, CSTD (C-6His) 500 µg 1755 € novo mouse
C397 Recombinant Human Cystatin D, CSTD, CST5 (C-6His) 10 µg 202 € novo human
MBS624515 CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624507 CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624238 CTSE, ID (Cathepsin E, Cathepsin E form I, Cathepsin E form II) Antibody 200ul 603 € MBS Polyclonals_1 human
CJ65 Recombinant Mouse Cathepsin B, CTSB (C-6His) 50 µg 496 € novo mouse
CD28 Recombinant Mouse Cathepsin E, CTSE (C-6His) 10 µg 202 € novo mouse
CK47 Recombinant Mouse Cathepsin H, CTSH (C-6His) 500 µg 1755 € novo mouse
CD24 Recombinant Mouse Cathepsin L, CTSL (C-6His) 50 µg 496 € novo mouse
CM37 Recombinant Mouse Cathepsin S, CTSS (C-6His) 50 µg 496 € novo mouse
RP-0227H Recombinant Human Cathepsin V / Cathepsin L2 / Preproprotein Protein (His Tag) 10μg 624 € adv human
CI11 Recombinant Human Cathepsin A, CTSA (C-6His) 500 µg 1613 € novo human
C398 Recombinant Human Cathepsin B, CTSB (C-6His) 1 mg 2283 € novo human
C399 Recombinant Human Cathepsin D, CTSD (C-6His) 50 µg 496 € novo human
C400 Recombinant Human Cathepsin E, CTSE (C-6His) 10 µg 202 € novo human
C401 Recombinant Human Cathepsin L, CTSL (C-6His) 500 µg 1613 € novo human
C460 Recombinant Human Cathepsin L2, CTSL2 (C-6His) 1 mg 2283 € novo human
C402 Recombinant Human Cathepsin S, CTSS (C-6His) 500 µg 1613 € novo human
C438 Recombinant Human Cathepsin Z, CTSZ (C-6His) 1 mg 2283 € novo human
CA28 Recombinant Human Pro-Cathepsin H, CTSH (C-6His) 10 µg 100 € novo human
YM8114 Cathepsin B, recombinant human, Mouse Monoclonal antibody-Human; Clone: CB131 1000ul 2005 € accurate-monoclonals human
YM8115 Cathepsin L, recombinant human, Mouse Monoclonal antibody-Human; Clone: 13C2 1000ul 2012 € accurate-monoclonals human
CTHD16-R-10 Recombinant (HEK) Mouse Liver Cathepsin D protein (CTSD, 1-410aa, His-tag, >95%) active 5 μg 405 € adi mouse
RP-1076M Recombinant Mouse Cathepsin A / CTSA Protein (His Tag) 20μg 572 € adv mouse
RP-1077M Recombinant Mouse Cathepsin B / CTSB Protein (His Tag) 10μg 624 € adv mouse
RP-1078M Recombinant Mouse Cathepsin D / CTSD Protein (His Tag) 10μg 624 € adv mouse
RP-1079M Recombinant Mouse Cathepsin E / CTSE Protein (His Tag) 10μg 624 € adv mouse
RP-1609M Recombinant Mouse Cathepsin H / CTSH Protein (His Tag) 10μg 624 € adv mouse
RP-1080M Recombinant Mouse Cathepsin L / CTSL Protein (His Tag) 10μg 624 € adv mouse
RP-1081M Recombinant Mouse Cathepsin S / CTSS Protein (His Tag) 10μg 624 € adv mouse