Recombinant Human Pro-Cathepsin H, CTSH (C-6His)

Contact us
Catalog number: CA28
Price: 624 €
Supplier: adv
Product name: Recombinant Human Pro-Cathepsin H, CTSH (C-6His)
Quantity: 10μg
Other quantities: 1 mg 943€ 50 µg 192€ 500 µg 674€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cathepsin H is produced by our Mammalian expression system and the target gene encoding Ala23-Val335 is expressed with a 6His tag at the C-terminus
Molecular Weight: 19 kD, 36
UniProt number: P09668
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AELSVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLVVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: CTSH | More about : CTSH
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CTSH (C-6His), Pro-Cathepsin H
Short name: CTSH (C-6His), Recombinant Pro-Cathepsin H
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: cathepsin H (C-6His), sapiens L-proline-Cathepsin H, recombinant H
Alternative technique: rec
Alternative to gene target: ACC-4 and ACC-5 and CPSB and minichain, CTSH and IDBG-25289 and ENSG00000103811 and 1512, CTSH and IDBG-630170 and ENSBTAG00000010992 and 510524, Ctsh and IDBG-190584 and ENSMUSG00000032359 and 13036, Extracellular, this GO :0001520 and outer dense fiber and cellular component this GO :0001656 and metanephros development and biological process this GO :0001669 and acrosomal vesicle and cellular component this GO :0001913 and T cell mediated cytotoxicity and biological process this GO :0002250 and adaptive immune response and biological process this GO :0002764 and immune response-regulating signaling pathway and biological process this GO :0004175 and endopeptidase activity and molecular function this GO :0004177 and aminopeptidase activity and molecular function this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0004252 and serine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005764 and lysosome and cellular component this GO :0005829 and cytosol and cellular component this GO :0005930 and axoneme and cellular component this GO :0006508 and proteolysis and biological process this GO :0007283 and spermatogenesis and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008656 and cysteine-type endopeptidase activator activity involved in apoptotic process and molecular function this GO :0010628 and positive regulation of gene expression and biological process this GO :0010634 and positive regulation of epithelial cell migration and biological process this GO :0010813 and neuropeptide catabolic process and biological process this GO :0010815 and bradykinin catabolic process and biological process this GO :0010952 and positive regulation of peptidase activity and biological process this GO :0016505 and peptidase activator activity involved in apoptotic process and molecular function this GO :0019882 and antigen processing and presentation and biological process this GO :0030108 and HLA-A specific activating MHC class I receptor activity and molecular function this GO :0030335 and positive regulation of cell migration and biological process this GO :0030984 and kininogen binding and molecular function this GO :0031638 and zymogen activation and biological process this GO :0031648 and protein destabilization and biological process this GO :0032403 and protein complex binding and molecular function this GO :0032526 and response to retinoic acid and biological process this GO :0033619 and membrane protein proteolysis and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043129 and surfactant homeostasis and biological process this GO :0043621 and protein self-association and molecular function this GO :0045087 and innate immune response and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0060448 and dichotomous subdivision of terminal units involved in lung branching and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070324 and thyroid hormone binding and molecular function this GO :0070371 and ERK1 and ERK2 cascade and biological process this GO :0097067 and cellular response to thyroid hormone stimulus and biological process this GO :0097208 and alveolar lamellar body and cellular component this GO :2001235 and positive regulation of apoptotic signaling pathway and biological process, this GO :0004175 : endopeptidase activity, this GO :0004175 : endopeptidase activity and also this GO :0004177 : aminopeptidase activity and also this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0004252 : serine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0008233 : peptidase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0008656 : cysteine-type endopeptidase activator activity involved in apoptotic process and also this GO :0016505 : peptidase activator activity involved in apoptotic process and also this GO :0030108 : HLA-A specific activating MHC class I receptor activity and also this GO :0030984 : kininogen binding and also this GO :0032403 : protein complex binding and also this GO :0043621 : protein self-association and also this GO :0070324 : thyroid hormone binding, this GO :0004177 : aminopeptidase activity, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0004252 : serine-type endopeptidase activity, this GO :0005515 : protein binding, this GO :0008233 : peptidase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0008656 : cysteine-type endopeptidase activator activity involved in apoptotic process, this GO :0016505 : peptidase activator activity involved in apoptotic process, this GO :0030108 : HLA-A specific activating MHC class I receptor activity, this GO :0030984 : kininogen binding, this GO :0032403 : protein complex binding, this GO :0043621 : protein self-association, this GO :0070324 : thyroid hormone binding, thyroid hormone binding, cathepsin H
Identity: 2535
Long gene name: cathepsin H
Synonyms gene: CPSB
Synonyms: ACC-4 ACC-5 ACC4 ACC5
Locus: 15q25, 1
Discovery year: 2001-06-22
GenBank acession: X07549
Entrez gene record: 1512
Pubmed identfication: 2849458
RefSeq identity: NM_004390
Classification: Cathepsins Minor histocompatibility antigens
Havana BLAST/BLAT: OTTHUMG00000144171

Related Products :

MBS624515 CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) Antibody 200ul 603 € MBS Polyclonals_1 human
SP-100816-1 FDC - SP (61 - 85), human (AA: Phe-Pro-Trp-Phe-Arg-Arg-Asn-Phe-Pro-Ile-Pro-Ile-Pro-Glu-Ser-Ala-Pro-Thr-Thr-Pro-Leu-Pro-Ser-Glu-Lys) (MW: 2925.41) 1 mg 260 € adi human
SP-54847-1 Salusin-α (AA: Ser-Gly-Ala-Leu-Pro-Pro-Ala-Pro-Ala-Ala-Pro-Arg-Pro-Ala-Leu-Arg-Ala-Gln-Arg-Ala-Gly-Pro-Ala-Gly-Pro-Gly-Ala-Lys-NH2) (MW: 2603.05) 1 mg 333 € adi human
CA28 Recombinant Human Pro-Cathepsin H, CTSH (C-6His) 10 µg 100 € novo human
SP-62542-1 Chorionic Gonadotropin-β(109-145) (human) (AA: Thr-Cys-Asp-Asp-Pro-Arg-Phe-Gln-Asp-Ser-Ser-Ser-Ser-Lys-Ala-Pro-Pro-Pro-Ser-Leu-Pro-Ser-Pro-Ser-Arg-Leu-Pro-Gly-Pro-Ser-Asp-Thr-Pro-Ile-Leu-Pro-Gln) (MW: 1268.31) 1 mg 405 € adi human
SP-75987-1 Osteocalcin (1-49) (human) [Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Gla-Pro-Arg-Arg-Gla-Val-Cys-Gla-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val] 0,1 mg 478 € adi human
SP-100826-1 Prepro-adrenomedullin (153 - 185), human (AA: Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu) (MW: 3219.6) 1 mg 260 € adi human
SP-58780-1 α-Gliadin (57–73) [Gln-Leu-Gln-Pro-Phe-Pro-Gln-Pro-Glu-Leu-Pro-Tyr-Pro-Gln-Pro-Gln-Ser (MW: 1994.25)] 1 mg 188 € adi human
SP-89345-5 Bradykinin Potentiator C (AA: Pyr-Gly-Leu-Pro-Pro-Gly-Pro-Pro-Ile-Pro-Pro) (MW: 1052.26) 5 mg 333 € adi human
SP-55378-5 Bradykinin Potentiator C [pGlu-Gly-Leu-Pro-Pro-Gly-Pro-Pro-Ile-Pro-Pro-OH; MW: 1052.26] 5 mg 159 € adi human
MBS620141 Corticoliberin, Pro (Pro-Corticoliberin, Pro-CRF, Pro-CRH, Pro Corticotropin releasing hormone, Pro Corticotropin-releasing factor) Antibody 100ug 774 € MBS Polyclonals_1 human
CK47 Recombinant Mouse Cathepsin H, CTSH (C-6His) 500 µg 1755 € novo mouse
SP-71114-1 Apelin-36, human (AA: Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe) (MW: 4195.92) 1 mg 333 € adi human
SP-88140-1 Big Gastrin - 1, human (AA: Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2) (MW: 3849.30) 1 mg 260 € adi human
SP-100829-1 Human AGRP (25-51) (AA: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu) (MW: 2894.5) 1 mg 260 € adi human
SP-87137-5 Osteocalcin (7-19) (human) (AA: Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg) (MW: 1407.6) 5 mg 333 € adi human
SP-100532-1 Prepro-Atrial Natriuretic Factor (56-92) (human) (AA: Glu-Val-Val-Pro-Pro-Gln-Val-Leu-Ser-Glu-Pro-Asn-Glu-Glu-Ala-Gly-Ala-Ala-Leu-Ser-Pro-Leu-Pro-Glu-Val-Pro-Pro-Trp-Thr-Gly-Glu-Val-Ser-Pro-Ala-Gln-Arg) (MW: 3878.3) 1 mg 405 € adi human
MBS624507 CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) Antibody 200ul 603 € MBS Polyclonals_1 human
SP-55377-5 Bradykinin Potentiator B [pGlu-Gly-Leu-Pro-Pro-Arg-Pro-Lys-Ile-Pro-Pro-OH; MW: 1182.46] 5 mg 159 € adi human
SP-101818-1 Brain Derived Basic Fibroblast Growth Factor (1-24) (AA: Pro-Ala-Leu-Pro-Glu-Asp-Gly-Gly-Ser-Gly-Ala-Phe-Pro-Pro-Gly-His-Phe-Lys-Asp-Pro-Lys-Arg-Leu-Tyr) (MW: 2553.86) 1 mg 260 € adi human
SP-87186-1 Decorsin, Leech (AA: Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu) (MW: 4383.87) 1 mg 478 € adi leech
SP-87461-1 [Des-Asp10]Decorsin, Leech [Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu; MW: 4268.78] 1 mg 478 € adi leech
SP-88462-1 Fibrinogen β-Chain (24-42) (AA: Glu-Glu-Ala-Pro-Ser-Leu-Arg-Pro-Ala-Pro-Pro-Pro-Ile-Ser-Gly-Gly-Gly-Tyr-Arg) (MW: 1951.19) 1 mg 333 € adi human
SP-52142-1 HBV core protein (128-140) [H-Thr-Pro-Pro-Ala-Tyr-Arg-Pro-Pro-Asn-Ala-Pro-Ile-Leu-OH; MW: 1406.64] 0,5 mg 159 € adi human
SP-52590-1 HCV-1 e2 Protein (484 - 499) (AA: Pro-Tyr-Cys-Trp-His-Tyr-Pro-Pro-Lys-Pro-Cys-Gly-Ile-Val-Pro-Ala) (MW: 1828.19) 1 mg 188 € adi human
GENTAUR-58b9bd6a79fd4 Pig Pro-cathepsin H (CTSH) 100ug 1663 € MBS Recombinant Proteins pig
GENTAUR-58b9bd6acf445 Pig Pro-cathepsin H (CTSH) 1000ug 1663 € MBS Recombinant Proteins pig
GENTAUR-58b9bd6b60272 Pig Pro-cathepsin H (CTSH) 100ug 2177 € MBS Recombinant Proteins pig
GENTAUR-58b9bd6bbe783 Pig Pro-cathepsin H (CTSH) 1000ug 2177 € MBS Recombinant Proteins pig
RP-1609M Recombinant Mouse Cathepsin H / CTSH Protein (His Tag) 10μg 624 € adv mouse