| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Cathepsin H is produced by our Mammalian expression system and the target gene encoding Ala23-Val335 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
19 kD, 36 |
| UniProt number: |
P09668 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AELSVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLVVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CTSH |
More about : CTSH |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CTSH (C-6His), Pro-Cathepsin H |
| Short name: |
CTSH (C-6His), Recombinant Pro-Cathepsin H |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cathepsin H (C-6His), sapiens L-proline-Cathepsin H, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ACC-4 and ACC-5 and CPSB and minichain, CTSH and IDBG-25289 and ENSG00000103811 and 1512, CTSH and IDBG-630170 and ENSBTAG00000010992 and 510524, Ctsh and IDBG-190584 and ENSMUSG00000032359 and 13036, Extracellular, this GO :0001520 and outer dense fiber and cellular component this GO :0001656 and metanephros development and biological process this GO :0001669 and acrosomal vesicle and cellular component this GO :0001913 and T cell mediated cytotoxicity and biological process this GO :0002250 and adaptive immune response and biological process this GO :0002764 and immune response-regulating signaling pathway and biological process this GO :0004175 and endopeptidase activity and molecular function this GO :0004177 and aminopeptidase activity and molecular function this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0004252 and serine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005764 and lysosome and cellular component this GO :0005829 and cytosol and cellular component this GO :0005930 and axoneme and cellular component this GO :0006508 and proteolysis and biological process this GO :0007283 and spermatogenesis and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008656 and cysteine-type endopeptidase activator activity involved in apoptotic process and molecular function this GO :0010628 and positive regulation of gene expression and biological process this GO :0010634 and positive regulation of epithelial cell migration and biological process this GO :0010813 and neuropeptide catabolic process and biological process this GO :0010815 and bradykinin catabolic process and biological process this GO :0010952 and positive regulation of peptidase activity and biological process this GO :0016505 and peptidase activator activity involved in apoptotic process and molecular function this GO :0019882 and antigen processing and presentation and biological process this GO :0030108 and HLA-A specific activating MHC class I receptor activity and molecular function this GO :0030335 and positive regulation of cell migration and biological process this GO :0030984 and kininogen binding and molecular function this GO :0031638 and zymogen activation and biological process this GO :0031648 and protein destabilization and biological process this GO :0032403 and protein complex binding and molecular function this GO :0032526 and response to retinoic acid and biological process this GO :0033619 and membrane protein proteolysis and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043129 and surfactant homeostasis and biological process this GO :0043621 and protein self-association and molecular function this GO :0045087 and innate immune response and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0060448 and dichotomous subdivision of terminal units involved in lung branching and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070324 and thyroid hormone binding and molecular function this GO :0070371 and ERK1 and ERK2 cascade and biological process this GO :0097067 and cellular response to thyroid hormone stimulus and biological process this GO :0097208 and alveolar lamellar body and cellular component this GO :2001235 and positive regulation of apoptotic signaling pathway and biological process, this GO :0004175 : endopeptidase activity, this GO :0004175 : endopeptidase activity and also this GO :0004177 : aminopeptidase activity and also this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0004252 : serine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0008233 : peptidase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0008656 : cysteine-type endopeptidase activator activity involved in apoptotic process and also this GO :0016505 : peptidase activator activity involved in apoptotic process and also this GO :0030108 : HLA-A specific activating MHC class I receptor activity and also this GO :0030984 : kininogen binding and also this GO :0032403 : protein complex binding and also this GO :0043621 : protein self-association and also this GO :0070324 : thyroid hormone binding, this GO :0004177 : aminopeptidase activity, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0004252 : serine-type endopeptidase activity, this GO :0005515 : protein binding, this GO :0008233 : peptidase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0008656 : cysteine-type endopeptidase activator activity involved in apoptotic process, this GO :0016505 : peptidase activator activity involved in apoptotic process, this GO :0030108 : HLA-A specific activating MHC class I receptor activity, this GO :0030984 : kininogen binding, this GO :0032403 : protein complex binding, this GO :0043621 : protein self-association, this GO :0070324 : thyroid hormone binding, thyroid hormone binding, cathepsin H |
| Identity: |
2535 |
| Long gene name: |
cathepsin H |
| Synonyms gene: |
CPSB |
| Synonyms: |
ACC-4 ACC-5 ACC4 ACC5 |
| Locus: |
15q25, 1 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
X07549 |
| Entrez gene record: |
1512 |
| Pubmed identfication: |
2849458 |
| RefSeq identity: |
NM_004390 |
| Classification: |
Cathepsins Minor histocompatibility antigens |
| Havana BLAST/BLAT: |
OTTHUMG00000144171 |