| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Cathepsin E is produced by our Mammalian expression system and the target gene encoding Ser20-Pro396 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
41, 78 kD |
| UniProt number: |
P14091 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 5, 2 um filtered solution of 20 mM MES, 5, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CTSE |
More about : CTSE |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CTSE (C-6His), Cathepsin E |
| Short name: |
CTSE (C-6His), Recombinant Cathepsin E |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cathepsin E (C-6His), sapiens Cathepsin E, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CATE, CTSE and IDBG-106216 and ENSG00000196188 and 1510, Ctse and IDBG-191348 and ENSMUSG00000004552 and 13034, multiple, protein homodimerization activity, this GO :0004190 and aspartic-type endopeptidase activity and molecular function this GO :0005768 and endosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0007586 and digestion and biological process this GO :0016540 and protein autoprocessing and biological process this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004190 : aspartic-type endopeptidase activity, this GO :0004190 : aspartic-type endopeptidase activity and also this GO :0042803 : protein homodimerization activity, this GO :0042803 : protein homodimerization activity, cathepsin E |
| Identity: |
2530 |
| Long gene name: |
cathepsin E |
| Locus: |
1q32, 1 |
| Discovery year: |
1989-05-19 |
| GenBank acession: |
BC042537 |
| Entrez gene record: |
1510 |
| Pubmed identfication: |
2369841 2674141 |
| RefSeq identity: |
NM_001910 |
| Classification: |
Cathepsins |
| Havana BLAST/BLAT: |
OTTHUMG00000036121 |