| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Cathepsin L2 is produced by our Mammalian expression system and the target gene encoding Val18-Val334 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
36, 69 kD |
| UniProt number: |
O60911 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 5, 2 um filtered solution of 20 mM MES, 5, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CTSV |
More about : CTSV |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CTSL2 (C-6His), Cathepsin L2 |
| Short name: |
CTSL2 (C-6His), Recombinant Cathepsin L2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cathepsin L2 (C-6His), sapiens Cathepsin L2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CATL2 and CTSL2 and CTSU, CTSL2 and IDBG-636677 and ENSBTAG00000017077 and 281108, CTSL2 and IDBG-77609 and ENSG00000136943 and 1515, Ctsl and IDBG-161957 and ENSMUSG00000021477 and 13039, histone binding, nuclei, this GO :0004177 and aminopeptidase activity and molecular function this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005764 and lysosome and cellular component this GO :0005773 and vacuole and cellular component this GO :0005902 and microvillus and cellular component this GO :0006508 and proteolysis and biological process this GO :0007154 and cell communication and biological process this GO :0007283 and spermatogenesis and biological process this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0008584 and male this GO nad development and biological process this GO :0009267 and cellular response to starvation and biological process this GO :0009749 and response to glucose and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010259 and multicellular organismal aging and biological process this GO :0010839 and negative regulation of keratinocyte proliferation and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016485 and protein processing and biological process this GO :0016540 and protein autoprocessing and biological process this GO :0016807 and cysteine-type carboxypeptidase activity and molecular function this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0021675 and nerve development and biological process this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030141 and secretory granule and cellular component this GO :0030198 and extracellular matrix organization and biological process this GO :0030984 and kininogen binding and molecular function this GO :0031069 and hair follicle morphogenesis and biological process this GO :0031410 and cytoplasmic vesicle and cellular component this GO :0032403 and protein complex binding and molecular function this GO :0034698 and response to this GO nadotropin and biological process this GO :0042277 and peptide binding and molecular function this GO :0042393 and histone binding and molecular function this GO :0042637 and catagen and biological process this GO :0043005 and neuron projection and cellular component this GO :0043202 and lysosomal lumen and cellular component this GO :0043204 and perikaryon and cellular component this GO :0045177 and apical part of cell and cellular component this GO :0046697 and decidualization and biological process this GO :0048102 and autophagic cell death and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0060008 and Sertoli cell differentiation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2000249 and regulation of actin cytoskeleton reorganization and biological process, this GO :0004177 : aminopeptidase activity, this GO :0004177 : aminopeptidase activity and also this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0016807 : cysteine-type carboxypeptidase activity and also this GO :0030984 : kininogen binding and also this GO :0032403 : protein complex binding and also this GO :0042277 : peptide binding and also this GO :0042393 : histone binding, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0005515 : protein binding, this GO :0008234 : cysteine-type peptidase activity, this GO :0016807 : cysteine-type carboxypeptidase activity, this GO :0030984 : kininogen binding, this GO :0032403 : protein complex binding, this GO :0042277 : peptide binding, this GO :0042393 : histone binding, cathepsin L2 |
| Identity: |
2538 |
| Long gene name: |
cathepsin V |
| Synonyms gene: |
CTSL2 |
| Synonyms gene name: |
cathepsin L2 |
| Synonyms: |
CTSU |
| Locus: |
9q22, 33 |
| Discovery year: |
1998-08-27 |
| GenBank acession: |
Y14734 |
| Entrez gene record: |
1515 |
| Pubmed identfication: |
9563472 10029531 |
| RefSeq identity: |
NM_001333 |
| Classification: |
Cathepsins |
| Havana BLAST/BLAT: |
OTTHUMG00000020314 |