| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Cathepsin D is produced by our Mammalian expression system and the target gene encoding Leu21-Leu412 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
43, 8 kD |
| UniProt number: |
P07339 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 5, 2 um filtered solution of 20 mM MES, 5, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CTSD |
More about : CTSD |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CTSD (C-6His), Cathepsin D |
| Short name: |
CTSD (C-6His), Recombinant Cathepsin D |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cathepsin D (C-6His), sapiens Cathepsin D, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CATD and IDBG-645332 and ENSBTAG00000007622 and 282883, CLN10 and CPSD and HEL-S-130P, CTSD and IDBG-19613 and ENSG00000117984 and 1509, Ctsd and IDBG-212523 and ENSMUSG00000007891 and 13033, Extracellular, protein binding, this GO :0004190 and aspartic-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005764 and lysosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0008219 and cell death and biological process this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0042470 and melanosome and cellular component this GO :0043202 and lysosomal lumen and cellular component this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004190 : aspartic-type endopeptidase activity, this GO :0004190 : aspartic-type endopeptidase activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, cathepsin D |
| Identity: |
2529 |
| Long gene name: |
cathepsin D |
| Synonyms gene: |
CPSD |
| Synonyms gene name: |
cathepsin D (lysosomal aspartyl protease) |
| Synonyms: |
CLN10 |
| Synonyms name: |
ceroid-lipofuscinosis, neuronal 10 |
| Locus: |
11p15, 5 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
M11233 |
| Entrez gene record: |
1509 |
| Pubmed identfication: |
3927292 |
| RefSeq identity: |
NM_001909 |
| Classification: |
Cathepsins |
| Havana BLAST/BLAT: |
OTTHUMG00000044760 |
| Locus Specific Databases: |
NCL Mutations , Neuronal Ceroid Lipofuscinoses |