| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Cathepsin S is produced by our Mammalian expression system and the target gene encoding Gln17-Ile331 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
36, 89 kD |
| UniProt number: |
P25774 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10% Glycerol, 150 mM sodium chloride, pH 5, 2 um filtered solution of 20 mM MES, 5, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNWILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CTSS |
More about : CTSS |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CTSS (C-6His), Cathepsin S |
| Short name: |
CTSS (C-6His), Recombinant Cathepsin S |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cathepsin S (C-6His), sapiens Cathepsin S, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CTSS and IDBG-102189 and ENSG00000163131 and 1520, CTSS and IDBG-633332 and ENSBTAG00000017135 and 327711, Ctss and IDBG-172850 and ENSMUSG00000038642 and 13040, Extracellular, TAP-independent and biological process this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005764 and lysosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0006955 and immune response and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0016020 and membrane and cellular component this GO :0019882 and antigen processing and presentation and biological process this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0034769 and basement membrane disassembly and biological process this GO :0036021 and endolysosome lumen and cellular component this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0043202 and lysosomal lumen and cellular component this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043236 and laminin binding and molecular function this GO :0043394 and proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0097067 and cellular response to thyroid hormone stimulus and biological process, proteoglycan binding, this GO :0001968 and fibronectin binding and molecular function this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002250 and adaptive immune response and biological process this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002480 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0001968 : fibronectin binding, this GO :0001968 : fibronectin binding and also this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005518 : collagen binding and also this GO :0008233 : peptidase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0043236 : laminin binding and also this GO :0043394 : proteoglycan binding, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0005518 : collagen binding, this GO :0008233 : peptidase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0043236 : laminin binding, this GO :0043394 : proteoglycan binding, cathepsin S |
| Identity: |
2545 |
| Long gene name: |
cathepsin S |
| Locus: |
1q21, 3 |
| Discovery year: |
1992-07-09 |
| GenBank acession: |
M90696 |
| Entrez gene record: |
1520 |
| Pubmed identfication: |
1373132 |
| RefSeq identity: |
NM_004079 |
| Classification: |
Cathepsins |
| Havana BLAST/BLAT: |
OTTHUMG00000035010 |