| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Cathepsin B is produced by our Mammalian expression system and the target gene encoding Arg18-Ile339 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
36, 9 kD |
| UniProt number: |
P07858 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
RSRPSFHPVSDELVNYVNKRNTTWQAGHNFYNVDMGYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKIVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CTSB |
More about : CTSB |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CTSB (C-6His), Cathepsin B |
| Short name: |
CTSB (C-6His), Recombinant Cathepsin B |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cathepsin B (C-6His), sapiens Cathepsin B, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
APPS and CPSB, CTSB and IDBG-629395 and ENSBTAG00000012442 and 281105, CTSB and IDBG-7654 and ENSG00000164733 and 1508, Ctsb and IDBG-172314 and ENSMUSG00000021939 and 13030, nuclei, proteoglycan binding, this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005764 and lysosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0030855 and epithelial cell differentiation and biological process this GO :0036021 and endolysosome lumen and cellular component this GO :0042470 and melanosome and cellular component this GO :0042981 and regulation of apoptotic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043394 and proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0046697 and decidualization and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050790 and regulation of catalytic activity and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097067 and cellular response to thyroid hormone stimulus and biological process, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0005518 : collagen binding and also this GO :0008233 : peptidase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0043394 : proteoglycan binding, this GO :0005515 : protein binding, this GO :0005518 : collagen binding, this GO :0008233 : peptidase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0043394 : proteoglycan binding, cathepsin B |
| Identity: |
2527 |
| Long gene name: |
cathepsin B |
| Locus: |
8p23, 1 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M14221 |
| Entrez gene record: |
1508 |
| Pubmed identfication: |
8112600 3463996 |
| RefSeq identity: |
NM_147780 |
| Classification: |
Cathepsins |
| Havana BLAST/BLAT: |
OTTHUMG00000090799 |