Recombinant Human Cathepsin B, CTSB (C-6His)

Contact us
Catalog number: C398
Price: 648 €
Supplier: genways
Product name: Recombinant Human Cathepsin B, CTSB (C-6His)
Quantity: 1 vial
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cathepsin B is produced by our Mammalian expression system and the target gene encoding Arg18-Ile339 is expressed with a 6His tag at the C-terminus
Molecular Weight: 36, 9 kD
UniProt number: P07858
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: RSRPSFHPVSDELVNYVNKRNTTWQAGHNFYNVDMGYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKIVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: CTSB | More about : CTSB
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CTSB (C-6His), Cathepsin B
Short name: CTSB (C-6His), Recombinant Cathepsin B
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: cathepsin B (C-6His), sapiens Cathepsin B, recombinant H
Alternative technique: rec
Alternative to gene target: APPS and CPSB, CTSB and IDBG-629395 and ENSBTAG00000012442 and 281105, CTSB and IDBG-7654 and ENSG00000164733 and 1508, Ctsb and IDBG-172314 and ENSMUSG00000021939 and 13030, nuclei, proteoglycan binding, this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005764 and lysosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0030855 and epithelial cell differentiation and biological process this GO :0036021 and endolysosome lumen and cellular component this GO :0042470 and melanosome and cellular component this GO :0042981 and regulation of apoptotic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043394 and proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0046697 and decidualization and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050790 and regulation of catalytic activity and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097067 and cellular response to thyroid hormone stimulus and biological process, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0005518 : collagen binding and also this GO :0008233 : peptidase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0043394 : proteoglycan binding, this GO :0005515 : protein binding, this GO :0005518 : collagen binding, this GO :0008233 : peptidase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0043394 : proteoglycan binding, cathepsin B
Identity: 2527
Long gene name: cathepsin B
Locus: 8p23, 1
Discovery year: 2001-06-22
GenBank acession: M14221
Entrez gene record: 1508
Pubmed identfication: 8112600 3463996
RefSeq identity: NM_147780
Classification: Cathepsins
Havana BLAST/BLAT: OTTHUMG00000090799

Related Products :

C398 Recombinant Human Cathepsin B, CTSB (C-6His) 1 mg 2283 € novo human
CJ65 Recombinant Mouse Cathepsin B, CTSB (C-6His) 50 µg 496 € novo mouse
MBS624515 CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624507 CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) Antibody 200ul 603 € MBS Polyclonals_1 human
CTHB16-N-10 Recombinant (HEK) Human Cathepsin B (CTSB) protein (18-339 aa, His-tag, >95%, low endotoxins 10 μg 405 € adi human
RP-0222H Recombinant Human Cathepsin B / CTSB Protein (His Tag) 10μg 624 € adv human
RP-1077M Recombinant Mouse Cathepsin B / CTSB Protein (His Tag) 10μg 624 € adv mouse
abx572408 Anti-Human Cathepsin B (CTSB) ELISA Kit 96 tests 789 € abbex human
MBS248791 Anti-Human CTSB / Cathepsin B Antibody 50ug 597 € MBS Polyclonals_1 human
DL-CTSB-Hu Human Cathepsin B CTSB ELISA Kit 96T 904 € DL elisas human
MBS248485 PAb (IgG) to Human CTSB / Cathepsin B Antibody 0.05 ml 597 € MBS Polyclonals_1 human
MBS624238 CTSE, ID (Cathepsin E, Cathepsin E form I, Cathepsin E form II) Antibody 200ul 603 € MBS Polyclonals_1 human
GENTAUR-58bdc2b71137c Anti- Cathepsin B (CTSB) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc2b759d72 Anti- Cathepsin B (CTSB) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc58b7c2ad Anti- Cathepsin B (CTSB) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc58bca955 Anti- Cathepsin B (CTSB) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcbfe4c5e4 Anti- Cathepsin B (CTSB) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcbfebc8ad Anti- Cathepsin B (CTSB) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd1ad57ff0 Anti- Cathepsin B (CTSB) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd21940343 Anti- Cathepsin B (CTSB) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd36cc5ece Anti- Cathepsin B (CTSB) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd64740997 Anti- Cathepsin B (CTSB) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd675a50a9 Anti- Cathepsin B (CTSB) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd6cb0a18a Anti- Cathepsin B (CTSB) Antibody 100ug 603 € MBS Polyclonals human
abx571764 Anti-Mouse Cathepsin B (CTSB) ELISA Kit 96 tests 804 € abbex mouse
abx571768 Anti-Rat Cathepsin B (CTSB) ELISA Kit inquire 50 € abbex rat
EKU03021 Cathepsin B (CTSB) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU03022 Cathepsin B (CTSB) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
EKU03023 Cathepsin B (CTSB) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
GWB-E6582A Cathepsin B (CTSB) Rabbit antibody to or anti-Rat Polyclonal antibody 1 vial 648 € genways rat