Recombinant Human Cathepsin Z, CTSZ (C-6His)

Contact us
Catalog number: C438
Price: 496 €
Supplier: novo
Product name: Recombinant Human Cathepsin Z, CTSZ (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cathepsin Z is produced by our Mammalian expression system and the target gene encoding Gly24-Val303 is expressed with a 6His tag at the C-terminus
Molecular Weight: 32, 51 kD
UniProt number: Q9UBR2
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 4, 2 um filtered solution of 20 mM HAc-NaAc, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIVVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: CTSZ | More about : CTSZ
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CTSZ (C-6His), Cathepsin Z
Short name: CTSZ (C-6His), Recombinant Cathepsin Z
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: cathepsin Z (C-6His), sapiens Cathepsin Z, recombinant H
Alternative technique: rec
Alternative to gene target: CTSX, CTSZ and IDBG-641151 and ENSBTAG00000018784 and 404187, CTSZ and IDBG-83296 and ENSG00000101160 and 1522, Ctsz and IDBG-213479 and ENSMUSG00000016256 and 64138, Extracellular, cysteine-type peptidase activity, this GO :0002003 and angiotensin maturation and biological process this GO :0005615 and extracellular space and cellular component this GO :0005764 and lysosome and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0044267 and cellular protein metabolic process and biological process this GO :0060441 and epithelial tube branching involved in lung morphogenesis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0008234 : cysteine-type peptidase activity, this GO :0008234 : cysteine-type peptidase activity, cathepsin Z
Identity: 2547
Long gene name: cathepsin Z
Synonyms: CTSX
Synonyms name: cathepsin X carboxypeptidase LB cathepsin IV cathepsin B2 cathepsin Y cathepsin Z1 cysteine-type carboxypeptidase lysosomal carboxypeptidase B
Locus: 20q13, 32
Discovery year: 1998-08-27
GenBank acession: AF032906
Entrez gene record: 1522
Pubmed identfication: 9642240
RefSeq identity: NM_001336
Classification: Cathepsins
Havana BLAST/BLAT: OTTHUMG00000032858

Related Products :

C438 Recombinant Human Cathepsin Z, CTSZ (C-6His) 1 mg 2283 € novo human
MBS624515 CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624507 CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) Antibody 200ul 603 € MBS Polyclonals_1 human
CTSZ31-N-10 Recombinant (HEK) Cathepsin Z/P (CTSZ) (24-303, full length, >95%, his-tag, low endotoxins) 10 μg 405 € adi human
RP-1223M Recombinant Mouse CTSZ / CTSX / Cathepsin Z Protein (His Tag) 10μg 624 € adv mouse
abx571168 Anti-Human Cathepsin Z (CTSZ) ELISA Kit inquire 50 € abbex human
DL-CTSZ-Hu Human Cathepsin Z CTSZ ELISA Kit 96T 904 € DL elisas human
abx575029 Anti-Mouse Cathepsin Z (CTSZ) ELISA Kit inquire 50 € abbex mouse
EKU03044 Cathepsin Z (CTSZ) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU03045 Cathepsin Z (CTSZ) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
DL-CTSZ-Mu Mouse Cathepsin Z CTSZ ELISA Kit 96T 921 € DL elisas mouse
MBS624238 CTSE, ID (Cathepsin E, Cathepsin E form I, Cathepsin E form II) Antibody 200ul 603 € MBS Polyclonals_1 human
RP-0513H Recombinant Human CTSZ Protein (His Tag) 10μg 624 € adv human
RP-0227H Recombinant Human Cathepsin V / Cathepsin L2 / Preproprotein Protein (His Tag) 10μg 624 € adv human
CI11 Recombinant Human Cathepsin A, CTSA (C-6His) 500 µg 1613 € novo human
C398 Recombinant Human Cathepsin B, CTSB (C-6His) 1 mg 2283 € novo human
C399 Recombinant Human Cathepsin D, CTSD (C-6His) 50 µg 496 € novo human
C400 Recombinant Human Cathepsin E, CTSE (C-6His) 10 µg 202 € novo human
C401 Recombinant Human Cathepsin L, CTSL (C-6His) 500 µg 1613 € novo human
C460 Recombinant Human Cathepsin L2, CTSL2 (C-6His) 1 mg 2283 € novo human
C402 Recombinant Human Cathepsin S, CTSS (C-6His) 500 µg 1613 € novo human
CA28 Recombinant Human Pro-Cathepsin H, CTSH (C-6His) 10 µg 100 € novo human
GWB-ATG511 CTSZ, 62-303aa, Human, His tag, E.coli bulk Ask price € genways bulk human
LV129959 CTSZ Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV129960 CTSZ Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV129961 CTSZ Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV129962 CTSZ Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV129964 CTSZ Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV129963 CTSZ Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
CJ65 Recombinant Mouse Cathepsin B, CTSB (C-6His) 50 µg 496 € novo mouse