| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Cathepsin Z is produced by our Mammalian expression system and the target gene encoding Gly24-Val303 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
32, 51 kD |
| UniProt number: |
Q9UBR2 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 4, 2 um filtered solution of 20 mM HAc-NaAc, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIVVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CTSZ |
More about : CTSZ |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CTSZ (C-6His), Cathepsin Z |
| Short name: |
CTSZ (C-6His), Recombinant Cathepsin Z |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cathepsin Z (C-6His), sapiens Cathepsin Z, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CTSX, CTSZ and IDBG-641151 and ENSBTAG00000018784 and 404187, CTSZ and IDBG-83296 and ENSG00000101160 and 1522, Ctsz and IDBG-213479 and ENSMUSG00000016256 and 64138, Extracellular, cysteine-type peptidase activity, this GO :0002003 and angiotensin maturation and biological process this GO :0005615 and extracellular space and cellular component this GO :0005764 and lysosome and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0044267 and cellular protein metabolic process and biological process this GO :0060441 and epithelial tube branching involved in lung morphogenesis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0008234 : cysteine-type peptidase activity, this GO :0008234 : cysteine-type peptidase activity, cathepsin Z |
| Identity: |
2547 |
| Long gene name: |
cathepsin Z |
| Synonyms: |
CTSX |
| Synonyms name: |
cathepsin X carboxypeptidase LB cathepsin IV cathepsin B2 cathepsin Y cathepsin Z1 cysteine-type carboxypeptidase lysosomal carboxypeptidase B |
| Locus: |
20q13, 32 |
| Discovery year: |
1998-08-27 |
| GenBank acession: |
AF032906 |
| Entrez gene record: |
1522 |
| Pubmed identfication: |
9642240 |
| RefSeq identity: |
NM_001336 |
| Classification: |
Cathepsins |
| Havana BLAST/BLAT: |
OTTHUMG00000032858 |