Recombinant Human Cathepsin E, CTSE (C-6His)

Contact us
Catalog number: C400
Price: 496 €
Supplier: novo
Product name: Recombinant Human Cathepsin E, CTSE (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cathepsin E is produced by our Mammalian expression system and the target gene encoding Ser20-Pro396 is expressed with a 6His tag at the C-terminus
Molecular Weight: 41, 78 kD
UniProt number: P14091
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 5, 2 um filtered solution of 20 mM MES, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: CTSE | More about : CTSE
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CTSE (C-6His), Cathepsin E
Short name: CTSE (C-6His), Recombinant Cathepsin E
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: cathepsin E (C-6His), sapiens Cathepsin E, recombinant H
Alternative technique: rec
Alternative to gene target: CATE, CTSE and IDBG-106216 and ENSG00000196188 and 1510, Ctse and IDBG-191348 and ENSMUSG00000004552 and 13034, multiple, protein homodimerization activity, this GO :0004190 and aspartic-type endopeptidase activity and molecular function this GO :0005768 and endosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0007586 and digestion and biological process this GO :0016540 and protein autoprocessing and biological process this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004190 : aspartic-type endopeptidase activity, this GO :0004190 : aspartic-type endopeptidase activity and also this GO :0042803 : protein homodimerization activity, this GO :0042803 : protein homodimerization activity, cathepsin E
Identity: 2530
Long gene name: cathepsin E
Locus: 1q32, 1
Discovery year: 1989-05-19
GenBank acession: BC042537
Entrez gene record: 1510
Pubmed identfication: 2369841 2674141
RefSeq identity: NM_001910
Classification: Cathepsins
Havana BLAST/BLAT: OTTHUMG00000036121

Related Products :

MBS624238 CTSE, ID (Cathepsin E, Cathepsin E form I, Cathepsin E form II) Antibody 200ul 603 € MBS Polyclonals_1 human
C400 Recombinant Human Cathepsin E, CTSE (C-6His) 10 µg 202 € novo human
CD28 Recombinant Mouse Cathepsin E, CTSE (C-6His) 10 µg 202 € novo mouse
MBS624515 CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624507 CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) Antibody 200ul 603 € MBS Polyclonals_1 human
CTSE41-N-10 Recombinant (HEK) Cathepsin E (CTSE) (20-396, full length, >95%, his-tag, low endotoxins) 10 μg 405 € adi human
RP-1079M Recombinant Mouse Cathepsin E / CTSE Protein (His Tag) 10μg 624 € adv mouse
RP-2025R Recombinant Rat Cathepsin E / CTSE Protein (His Tag) 10μg 624 € adv rat
abx572440 Anti-Human Cathepsin E (CTSE) ELISA Kit 96 tests 789 € abbex human
DL-CTSE-Hu Human Cathepsin E CTSE ELISA Kit 96T 904 € DL elisas human
EKU03029 Cathepsin E (CTSE) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
AE48441GU-48 ELISA test for Guinea pig Cathepsin E (CTSE) 1x plate of 48 wells 402 € abebio human
AE48439MO-48 ELISA test for Mouse Cathepsin E (CTSE) 1x plate of 48 wells 373 € abebio mouse
AE48441GU Guinea pig Cathepsin E (CTSE) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE48441GU-96 Guinea pig Cathepsin E (CTSE) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE48439MO-96 Mouse Cathepsin E (CTSE) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
GENTAUR-58b9c561b294c Rat Cathepsin E (Ctse) 100ug 1973 € MBS Recombinant Proteins rat
GENTAUR-58b9c5621ab5d Rat Cathepsin E (Ctse) 1000ug 1973 € MBS Recombinant Proteins rat
GENTAUR-58b9c56270162 Rat Cathepsin E (Ctse) 100ug 2487 € MBS Recombinant Proteins rat
GENTAUR-58b9c562de98e Rat Cathepsin E (Ctse) 1000ug 2487 € MBS Recombinant Proteins rat
RP-0227H Recombinant Human Cathepsin V / Cathepsin L2 / Preproprotein Protein (His Tag) 10μg 624 € adv human
CI11 Recombinant Human Cathepsin A, CTSA (C-6His) 500 µg 1613 € novo human
C398 Recombinant Human Cathepsin B, CTSB (C-6His) 1 mg 2283 € novo human
C399 Recombinant Human Cathepsin D, CTSD (C-6His) 50 µg 496 € novo human
C401 Recombinant Human Cathepsin L, CTSL (C-6His) 500 µg 1613 € novo human
C460 Recombinant Human Cathepsin L2, CTSL2 (C-6His) 1 mg 2283 € novo human
C402 Recombinant Human Cathepsin S, CTSS (C-6His) 500 µg 1613 € novo human
C438 Recombinant Human Cathepsin Z, CTSZ (C-6His) 1 mg 2283 € novo human
CA28 Recombinant Human Pro-Cathepsin H, CTSH (C-6His) 10 µg 100 € novo human
CJ65 Recombinant Mouse Cathepsin B, CTSB (C-6His) 50 µg 496 € novo mouse