| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
8 kD, 9 |
| UniProt number: |
Q9Z121 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH3O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to_x005F_x001E_ࣈࣈ_x005F_x001E__x005F_x001E_ࣈࣈ_x005F_x001E__x005F_x001E_ࣈࣈ, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQPHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CCL8, MCP-2 (C-6His), C-C motif Chemokine 8 |
| Short name: |
CCL8, MCP-2 (C-6His), Recombinant Mouse C-C motif Chemokine 8 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
MCP-2 (C-6His), chemokine (C-C motif) ligand 8, recombinant Mouse C-C motif Chemokine 8 |
| Alternative technique: |
rec |
| Alternative to gene target: |
CCL8 and IDBG-40686 and ENSG00000108700 and 6355, CCL8 and IDBG-630945 and ENSBTAG00000014113 and 281044, Extracellular, HC14 and MCP-2 and MCP2 and SCYA10 and SCYA8, phospholipase activator activity, this GO :0004672 and protein kinase activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006816 and calcium ion transport and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006887 and exocytosis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0009615 and response to virus and biological process this GO :0016004 and phospholipase activator activity and molecular function this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0016004 : phospholipase activator activity, this GO :0008009 : chemokine activity, this GO :0008201 : heparin binding, this GO :0016004 : phospholipase activator activity, 788169, chemokine (C-C motif) ligand 8 |
| Identity: |
10635 |
| Gene: |
CCL8 |
More about : CCL8 |
| Long gene name: |
C-C motif chemokine ligand 8 |
| Synonyms gene: |
SCYA8 |
| Synonyms gene name: |
member 8 (monocyte chemotactic protein 2) chemokine (C-C motif) ligand 8 , small inducible cytokine subfamily A (Cys-Cys) |
| Synonyms: |
MCP-2 HC14 |
| Locus: |
17q12 |
| Discovery year: |
1996-11-14 |
| GenBank acession: |
X99886 |
| Entrez gene record: |
6355 |
| Pubmed identfication: |
9119400 |
| RefSeq identity: |
NM_005623 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000132883 |