Recombinant Mouse C-C motif Chemokine 8, CCL8, MCP-2 (C-6His)

Contact us
Catalog number: CS45
Price: 1613 €
Supplier: novo
Product name: Recombinant Mouse C-C motif Chemokine 8, CCL8, MCP-2 (C-6His)
Quantity: 500 µg
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 8 kD, 9
UniProt number: Q9Z121
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH3O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to_x005F_x001E_ࣈࣈ_x005F_x001E__x005F_x001E_ࣈࣈ_x005F_x001E__x005F_x001E_ࣈࣈ, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQPHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CCL8, MCP-2 (C-6His), C-C motif Chemokine 8
Short name: CCL8, MCP-2 (C-6His), Recombinant Mouse C-C motif Chemokine 8
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: MCP-2 (C-6His), chemokine (C-C motif) ligand 8, recombinant Mouse C-C motif Chemokine 8
Alternative technique: rec
Alternative to gene target: CCL8 and IDBG-40686 and ENSG00000108700 and 6355, CCL8 and IDBG-630945 and ENSBTAG00000014113 and 281044, Extracellular, HC14 and MCP-2 and MCP2 and SCYA10 and SCYA8, phospholipase activator activity, this GO :0004672 and protein kinase activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006816 and calcium ion transport and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006887 and exocytosis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0009615 and response to virus and biological process this GO :0016004 and phospholipase activator activity and molecular function this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0016004 : phospholipase activator activity, this GO :0008009 : chemokine activity, this GO :0008201 : heparin binding, this GO :0016004 : phospholipase activator activity, 788169, chemokine (C-C motif) ligand 8
Identity: 10635
Gene: CCL8 | More about : CCL8
Long gene name: C-C motif chemokine ligand 8
Synonyms gene: SCYA8
Synonyms gene name: member 8 (monocyte chemotactic protein 2) chemokine (C-C motif) ligand 8 , small inducible cytokine subfamily A (Cys-Cys)
Synonyms: MCP-2 HC14
Locus: 17q12
Discovery year: 1996-11-14
GenBank acession: X99886
Entrez gene record: 6355
Pubmed identfication: 9119400
RefSeq identity: NM_005623
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000132883

Related Products :

CS45 Recombinant Mouse C-C motif Chemokine 8, CCL8, MCP-2 (C-6His) 10 µg 202 € novo mouse
CC95 Recombinant Human C-C Motif Chemokine 8, CCL8, MCP-2 (C-6His) 1 mg 2283 € novo human
C063 Recombinant Human C-C Motif Chemokine 8, CCL8, MCP-2 10 µg 202 € novo human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
CM78 Recombinant Human C-C Motif Chemokine 2, CCL2, MCP-1 500 µg 1755 € novo human
RP-0234H Recombinant Human CCL8 / MCP-2 Protein (His Tag) 10μg 346 € adv human
GWB-BIG0CA Recombinant Human MCP-2 (CCL8) bulk Ask price € genways bulk human
GWB-BIG189 Recombinant Murine MCP-2 (CCL8) bulk Ask price € genways bulk human
CS16 Recombinant Mouse C-C motif chemokine 2, CCL2 (C-6His) 1 mg 2486 € novo mouse
CR13 Recombinant Mouse C-C Motif Chemokine 3, CCL3, MIP-1a(N-6His) 1 mg 2486 € novo mouse
C786 Recombinant Mouse C-X-C Motif Chemokine 1, CXCL1, GRO α (C-6His) 1 mg 2283 € novo human
CJ85 Recombinant Mouse C-X-C motif Chemokine 15, CXCL15, Lungkine (C-6His) 500 µg 1613 € novo mouse
CC44 Recombinant Mouse C-X-C Motif Chemokine 16, CXCL16, SR-PSOX (C-6His) 1 mg 2283 € novo mouse
CI38 Recombinant Mouse C-X3-C Motif Chemokine 1, CX3CL1, Fractalkine (C-6His) 500 µg 1613 € novo mouse
C439 Recombinant Human C-C Motif Chemokine 14, CCL14, HCC-3 (C-6His) 10 µg 156 € novo human
C599 Recombinant Human C-C motif chemokine 17, CCL17 (C-6His) 10 µg 126 € novo human
CF38 Recombinant Human C-C Motif Chemokine 18, CCL18, PARC (N-6His) 10 µg 202 € novo human
CC43 Recombinant Human C-C Motif Chemokine 24, CCL24, Eotaxin-2, MPIF-2 (C-6His) 1 mg 2283 € novo human
C515 Recombinant Human C-C Motif Chemokine 3-Like 1, CCL3L1 (C-6His) 10 µg 202 € novo human
C569 Recombinant Human C-C Motif Chemokine 4, CCL4 (C-6His) 500 µg 1613 € novo human