| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
10, 8 kD |
| UniProt number: |
P10855 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1 mM EDTA, 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, 5%Trehalose, Lyophilized from a 0, pH8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH3O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to斯㉠쓐㍂ፀ㢄Å, Always centrifuge tubes before opening, _x005F_x0007__x005F_x0013_耀ؿ_x005F_x0016__x005F_x0017__x005F_x0013_耀, g/ml, _x005F_x0013__x005F_x0002_㉠㢄Å |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMDDDDKAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CCL3, MIP-1a(N-6His), C-C Motif Chemokine 3 |
| Short name: |
CCL3, MIP-1a(N-6His), Recombinant Mouse C-C Motif Chemokine 3 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
MIP-1a(N-6His), chemokine (C-C motif) ligand 3, recombinant Mouse C-C Motif Chemokine 3 |
| Alternative technique: |
rec |
| Alternative to gene target: |
CCL3 and IDBG-776925 and ENSG00000277632 and 6348, Extracellular, G0S19-1 and LD78ALPHA and MIP-1-alpha and MIP1A and SCYA3, identical protein binding, this GO :0000165 and MAPK cascade and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0001775 and cell activation and biological process this GO :0002548 and monocyte chemotaxis and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004698 and calcium-dependent protein kinase C activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006816 and calcium ion transport and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006887 and exocytosis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007010 and cytoskeleton organization and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007610 and behavior and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008360 and regulation of cell shape and biological process this GO :0009636 and response to toxic substance and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010818 and T cell chemotaxis and biological process this GO :0014808 and release of sequestered calcium ion into cytosol by sarcoplasmic reticulum and biological process this GO :0016004 and phospholipase activator activity and molecular function this GO :0016301 and kinase activity and molecular function this GO :0019722 and calcium-mediated signaling and biological process this GO :0023052 and signaling and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030502 and negative regulation of bone mineralization and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0031726 and CCR1 chemokine receptor binding and molecular function this GO :0031730 and CCR5 chemokine receptor binding and molecular function this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0042802 and identical protein binding and molecular function this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0043308 and eosinophil degranulation and biological process this GO :0043491 and protein kinase B signaling and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0043615 and astrocyte cell migration and biological process this GO :0043922 and negative regulation by host of viral transcription and biological process this GO :0045671 and negative regulation of osteoclast differentiation and biological process this GO :0048245 and eosinophil chemotaxis and biological process this GO :0048246 and macrophage chemotaxis and biological process this GO :0048247 and lymphocyte chemotaxis and biological process this GO :0050718 and positive regulation of interleukin-1 beta secretion and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050850 and positive regulation of calcium-mediated signaling and biological process this GO :0050918 and positive chemotaxis and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0051928 and positive regulation of calcium ion transport and biological process this GO :0051930 and regulation of sensory perception of pain and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070723 and response to cholesterol and biological process this GO :0071346 and cellular response to interferon-gamma and biological process this GO :0071347 and cellular response to interleukin-1 and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071621 and granulocyte chemotaxis and biological process this GO :0090280 and positive regulation of calcium ion import and biological process this GO :2000503 and positive regulation of natural killer cell chemotaxis and biological process, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004698 : calcium-dependent protein kinase C activity and also this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity and also this GO :0016004 : phospholipase activator activity and also this GO :0016301 : kinase activity and also this GO :0031726 : CCR1 chemokine receptor binding and also this GO :0031730 : CCR5 chemokine receptor binding and also this GO :0042056 : chemoattractant activity and also this GO :0042802 : identical protein binding, this GO :0004698 : calcium-dependent protein kinase C activity, this GO :0005515 : protein binding, this GO :0008009 : chemokine activity, this GO :0016004 : phospholipase activator activity, this GO :0016301 : kinase activity, this GO :0031726 : CCR1 chemokine receptor binding, this GO :0031730 : CCR5 chemokine receptor binding, this GO :0042056 : chemoattractant activity, this GO :0042802 : identical protein binding, chemokine (C-C motif) ligand 3 |
| Identity: |
10627 |
| Gene: |
CCL3 |
More about : CCL3 |
| Long gene name: |
C-C motif chemokine ligand 3 |
| Synonyms gene: |
SCYA3 |
| Synonyms gene name: |
small inducible cytokine A3 (homologous to mouse Mip-1a) chemokine (C-C motif) ligand 3 |
| Synonyms: |
G0S19-1 LD78ALPHA MIP-1-alpha |
| Locus: |
17q12 |
| Discovery year: |
1990-07-05 |
| GenBank acession: |
M23178 |
| Entrez gene record: |
6348 |
| RefSeq identity: |
NM_002983 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000188413 |