| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
8, 9 kD |
| UniProt number: |
P80075 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CCL8, MCP-2, C-C Motif Chemokine 8 |
| Short name: |
CCL8, MCP-2, Recombinant C-C Motif Chemokine 8 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
MCP-2, chemokine (C-C motif) ligand 8, sapiens C-C Motif Chemokine 8, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CCL8 and IDBG-40686 and ENSG00000108700 and 6355, CCL8 and IDBG-630945 and ENSBTAG00000014113 and 281044, Extracellular, HC14 and MCP-2 and MCP2 and SCYA10 and SCYA8, phospholipase activator activity, this GO :0004672 and protein kinase activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006816 and calcium ion transport and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006887 and exocytosis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0009615 and response to virus and biological process this GO :0016004 and phospholipase activator activity and molecular function this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0016004 : phospholipase activator activity, this GO :0008009 : chemokine activity, this GO :0008201 : heparin binding, this GO :0016004 : phospholipase activator activity, 788169, chemokine (C-C motif) ligand 8 |
| Identity: |
10635 |
| Gene: |
CCL8 |
More about : CCL8 |
| Long gene name: |
C-C motif chemokine ligand 8 |
| Synonyms gene: |
SCYA8 |
| Synonyms gene name: |
member 8 (monocyte chemotactic protein 2) chemokine (C-C motif) ligand 8 , small inducible cytokine subfamily A (Cys-Cys) |
| Synonyms: |
MCP-2 HC14 |
| Locus: |
17q12 |
| Discovery year: |
1996-11-14 |
| GenBank acession: |
X99886 |
| Entrez gene record: |
6355 |
| Pubmed identfication: |
9119400 |
| RefSeq identity: |
NM_005623 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000132883 |