| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human C-C motif chemokine 17 is produced by our Mammalian expression system and the target gene encoding Ala24, Ser94 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
1 kD, 9 |
| UniProt number: |
Q92583 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CCL17 (C-6His), C-C motif chemokine 17 |
| Short name: |
CCL17 (C-6His), Recombinant C-C motif chemokine 17 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
chemokine (C-C motif) ligand 17 (C-6His), sapiens C-C motif chemokine 17, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
A-152E5, CCL17 and IDBG-33236 and ENSG00000102970 and 6361, CCL17 and IDBG-632473 and ENSBTAG00000001191 and 100140488, CCR4 chemokine receptor binding, Ccl17 and IDBG-182659 and ENSMUSG00000031780 and 20295, Extracellular, this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0031729 and CCR4 chemokine receptor binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008009 : chemokine activity and also this GO :0031729 : CCR4 chemokine receptor binding, this GO :0008009 : chemokine activity, this GO :0031729 : CCR4 chemokine receptor binding, 3 and ABCD-2 and SCYA17 and TARC, chemokine (C-C motif) ligand 17 |
| Identity: |
10615 |
| Gene: |
CCL17 |
More about : CCL17 |
| Long gene name: |
C-C motif chemokine ligand 17 |
| Synonyms gene: |
SCYA17 |
| Synonyms gene name: |
member 17 chemokine (C-C motif) ligand 17 , small inducible cytokine subfamily A (Cys-Cys) |
| Synonyms: |
TARC ABCD-2 |
| Locus: |
16q21 |
| Discovery year: |
1996-10-26 |
| GenBank acession: |
D43767 |
| Entrez gene record: |
6361 |
| Pubmed identfication: |
8702936 9070951 |
| RefSeq identity: |
NM_002987 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000133468 |