| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human B7 Homolog 6 is produced by our Mammalian expression system and the target gene encoding Asp25-Ser262 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
27, 5 kD |
| UniProt number: |
Q68D85 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
B7-H6, NCR3LG1(C-6His), B7 Homolog 6 |
| Short name: |
B7-H6, NCR3LG1(C-6His), Recombinant B7 Homolog 6 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
B7-H6, NCR3LG1(C-6His), sapiens B7 Homolog 6, recombinant H |
| Alternative technique: |
rec |
| Identity: |
42400 |
| Gene: |
NCR3LG1 |
More about : NCR3LG1 |
| Long gene name: |
natural killer cell cytotoxicity receptor 3 ligand 1 |
| Synonyms: |
DKFZp686O24166 B7-H6 |
| Synonyms name: |
B7 homolog 6 |
| Locus: |
11p15, 1 |
| Discovery year: |
2012-04-12 |
| Entrez gene record: |
374383 |
| Pubmed identfication: |
19528259 |
| RefSeq identity: |
NM_001202439 |
| Classification: |
Endogenous ligands C1-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000165913 |