| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human Autophagy protein 3 is produced by our E, coli expression system and the target gene encoding Met1-His287 is expressed with a T7 tag at the N-terminus |
| Molecular Weight: |
35 kD |
| UniProt number: |
Q9NT62 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MASMTGGQQMGRGSMQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ATG3 (C-6His, N-T7 tag), Autophagy Related 3 Homolog |
| Short name: |
ATG3 (C-6His, N-T7 tag), Recombinant Autophagy 3 Homolog |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Label: |
tag |
| Species: |
Humans, Human |
| Alternative name: |
N-T7 detection labelled), autophagy related 3 (C-6His, sapiens Autophagy Related 3 Homolog, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ATG3 and IDBG-49891 and ENSG00000144848 and 64422, ATG3 and IDBG-632300 and ENSBTAG00000009084 and 508571, Atg3 and IDBG-162821 and ENSMUSG00000022663 and 67841, Cytoplasm, enzyme binding, this GO :0000045 and autophagic vacuole assembly and biological process this GO :0000153 and cytoplasmic ubiquitin ligase complex and cellular component this GO :0000422 and mitochondrion degradation and biological process this GO :0005515 and protein binding and molecular function this GO :0005829 and cytosol and cellular component this GO :0006464 and cellular protein modification process and biological process this GO :0006612 and protein targeting to membrane and biological process this GO :0006914 and autophagy and biological process this GO :0016567 and protein ubiquitination and biological process this GO :0019776 and Atg8 ligase activity and molecular function this GO :0019777 and Atg12 ligase activity and molecular function this GO :0019787 and small conjugating protein ligase activity and molecular function this GO :0019899 and enzyme binding and molecular function this GO :0043653 and mitochondrial fragmentation involved in apoptotic process and biological process this GO :0044804 and nucleophagy and biological process this GO :1902017 and regulation of cilium assembly and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0019776 : Atg8 ligase activity and also this GO :0019777 : Atg12 ligase activity and also this GO :0019787 : small conjugating protein ligase activity and also this GO :0019899 : enzyme binding, this GO :0019776 : Atg8 ligase activity, this GO :0019777 : Atg12 ligase activity, this GO :0019787 : small conjugating protein ligase activity, this GO :0019899 : enzyme binding, autophagy related 3 |
| Identity: |
20962 |
| Gene: |
ATG3 |
More about : ATG3 |
| Long gene name: |
autophagy related 3 |
| Synonyms gene: |
APG3L |
| Synonyms gene name: |
APG3 autophagy 3-like (S, cerevisiae) , cerevisiae) ATG3 autophagy related 3 homolog (S |
| Synonyms: |
PC3-96 FLJ22125 MGC15201 DKFZp564M1178 |
| Locus: |
3q13, 2 |
| Discovery year: |
2004-07-05 |
| Entrez gene record: |
64422 |
| Pubmed identfication: |
11825910 |
| RefSeq identity: |
NM_022488 |
| Classification: |
Autophagy related |
| Havana BLAST/BLAT: |
OTTHUMG00000159260 |