| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human Autophagy protein 10 is produced by our E, coli expression system and the target gene encoding Met1-Thr190 is expressed with a T7 tag at the N-terminus |
| Molecular Weight: |
24, 5 kD |
| UniProt number: |
Q9H0Y0 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM PB, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MASMTGGQQMGRGSMEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ATG10 (C-6His, N-T7 tag), Autophagy Related 10 Homolog |
| Short name: |
ATG10 (C-6His, N-T7 tag), Recombinant Autophagy 10 Homolog |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Label: |
tag |
| Species: |
Humans, Human |
| Alternative name: |
ATG10 (C-6His, N-T7 detection labelled), sapiens Autophagy Related 10 Homolog, recombinant H |
| Alternative technique: |
rec |
| Identity: |
20315 |
| Gene: |
ATG10 |
More about : ATG10 |
| Long gene name: |
autophagy related 10 |
| Synonyms gene: |
APG10L |
| Synonyms gene name: |
APG10 autophagy 10-like (S, cerevisiae) , cerevisiae) ATG10 autophagy related 10 homolog (S |
| Synonyms: |
DKFZP586I0418 FLJ13954 |
| Locus: |
5q14, 1-q14, 2 |
| Discovery year: |
2003-01-28 |
| GenBank acession: |
AK024016 |
| Entrez gene record: |
83734 |
| RefSeq identity: |
NM_001131028 |
| Classification: |
Autophagy related |
| Havana BLAST/BLAT: |
OTTHUMG00000119041 |