| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human NGAL is produced by our Mammalian expression system and the target gene encoding Gln21-Gly198 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
21, 6 kD |
| UniProt number: |
P80188 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
50% glycerol, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Cells), LCN2 (C-6His, Lipocalin-2, NGAL |
| Short name: |
Cells), LCN2 (C-6His, Lipocalin-2, Recombinant NGAL |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
H, Lipocalin-2, lipocalin 2 (C-6His, sapiens Cells), sapiens NGAL, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
24p3 and MSFI and NGAL, BT, Extracellular, LCN2 and IDBG-87415 and ENSG00000148346 and 3934, Lcn2 and IDBG-160059 and ENSMUSG00000026822 and 16819, protein homodimerization activity, this GO :0002020 and protease binding and molecular function this GO :0005215 and transporter activity and molecular function this GO :0005506 and iron ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005829 and cytosol and cellular component this GO :0006810 and transport and biological process this GO :0006811 and ion transport and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0009615 and response to virus and biological process this GO :0009617 and response to bacterium and biological process this GO :0009635 and response to herbicide and biological process this GO :0009636 and response to toxic substance and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0015891 and siderophore transport and biological process this GO :0031346 and positive regulation of cell projection organization and biological process this GO :0031667 and response to nutrient levels and biological process this GO :0031669 and cellular response to nutrient levels and biological process this GO :0036094 and small molecule binding and molecular function this GO :0042493 and response to drug and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070207 and protein homotrimerization and biological process this GO :0070301 and cellular response to hydrogen peroxide and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071347 and cellular response to interleukin-1 and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005215 : transporter activity and also this GO :0005506 : iron ion binding and also this GO :0005515 : protein binding and also this GO :0036094 : small molecule binding and also this GO :0042803 : protein homodimerization activity, this GO :0005215 : transporter activity, this GO :0005506 : iron ion binding, this GO :0005515 : protein binding, this GO :0036094 : small molecule binding, this GO :0042803 : protein homodimerization activity, 61865 and IDBG-639105 and ENSBTAG00000014149 and 526639, lipocalin 2 |
| Identity: |
6526 |
| Gene: |
LCN2 |
More about : LCN2 |
| Long gene name: |
lipocalin 2 |
| Synonyms gene name: |
lipocalin 2 (oncogene 24p3) |
| Synonyms: |
NGAL 24p3 |
| Synonyms name: |
oncogene 24p3 neutrophil gelatinase-associated lipocalin siderocalin |
| Locus: |
9q34, 11 |
| Discovery year: |
1994-04-29 |
| Entrez gene record: |
3934 |
| Pubmed identfication: |
7683678 |
| RefSeq identity: |
NM_005564 |
| Classification: |
Lipocalins |
| Havana BLAST/BLAT: |
OTTHUMG00000020734 |