| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human HPGD is produced by our Mammalian expression system and the target gene encoding Met1-Gln266 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
30 kD |
| UniProt number: |
P15428 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM HEPES, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HPGD (C-6His), 15-PGDH |
| Short name: |
HPGD (C-6His), Recombinant 15-PGDH |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
hydroxyprostaglandin dehydrogenase 15-(Nicotinamide adenine dinucleotide) (C-6His), sapiens 15-PGDH, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
15-PGDH and PGDH and PGDH1 and PHOAR1 and SDR36C1, BT, HPGD and IDBG-44946 and ENSG00000164120 and 3248, Hpgd and IDBG-155950 and ENSMUSG00000031613 and 15446, NAD+ binding, Plasma membranes, this GO :0003824 and catalytic activity and molecular function this GO :0004957 and prostaglandin E receptor activity and molecular function this GO :0005829 and cytosol and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007565 and female pregnancy and biological process this GO :0007567 and parturition and biological process this GO :0008152 and metabolic process and biological process this GO :0016323 and basolateral plasma membrane and cellular component this GO :0016404 and 15-hydroxyprostaglandin dehydrogenase (NAD+) activity and molecular function this GO :0016491 and oxidoreductase activity and molecular function this GO :0019369 and arachidonic acid metabolic process and biological process this GO :0019371 and cyclooxygenase pathway and biological process this GO :0019372 and lipoxygenase pathway and biological process this GO :0030728 and ovulation and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0044281 and small molecule metabolic process and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0050662 and coenzyme binding and molecular function this GO :0051287 and NAD binding and molecular function this GO :0055114 and oxidation-reduction process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070403 and NAD+ binding and molecular function this GO :0070493 and thrombin receptor signaling pathway and biological process this GO :0097070 and ductus arteriosus closure and biological process this GO :2001300 and lipoxin metabolic process and biological process, this GO :0003824 : catalytic activity, this GO :0003824 : catalytic activity and also this GO :0004957 : prostaglandin E receptor activity and also this GO :0016404 : 15-hydroxyprostaglandin dehydrogenase (NAD+) activity and also this GO :0016491 : oxidoreductase activity and also this GO :0042803 : protein homodimerization activity and also this GO :0050662 : coenzyme binding and also this GO :0051287 : NAD binding and also this GO :0070403 : NAD+ binding, this GO :0004957 : prostaglandin E receptor activity, this GO :0016404 : 15-hydroxyprostaglandin dehydrogenase (NAD+) activity, this GO :0016491 : oxidoreductase activity, this GO :0042803 : protein homodimerization activity, this GO :0050662 : coenzyme binding, this GO :0051287 : NAD binding, this GO :0070403 : NAD+ binding, 43717 and IDBG-629346 and ENSBTAG00000025942 and 512259, hydroxyprostaglandin dehydrogenase 15-(NAD) |
| Identity: |
5154 |
| Gene: |
HPGD |
More about : HPGD |
| Long gene name: |
hydroxyprostaglandin dehydrogenase 15-(NAD) |
| Synonyms: |
SDR36C1 |
| Synonyms name: |
member 1 , short chain dehydrogenase/reductase family 36C |
| Locus: |
4q34, 1 |
| Discovery year: |
1991-07-16 |
| Entrez gene record: |
3248 |
| Pubmed identfication: |
19027726 |
| Classification: |
Short chain dehydrogenase/reductase superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000160772 |