| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Autophagy protein 4C is produced by our E, coli expression system and the target gene encoding Met1-Leu458 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
53, 56 kD |
| UniProt number: |
Q96DT6 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10% Glycerol, 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLLLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ATG4C (C-6His), Autophagy Related 4 Homolog C |
| Short name: |
ATG4C (C-6His), Recombinant Autophagy 4 Homolog C |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
ATG4C (C-6His), sapiens Autophagy Related 4 Homolog C, recombinant H |
| Alternative technique: |
rec |
| Identity: |
16040 |
| Gene: |
ATG4C |
More about : ATG4C |
| Long gene name: |
autophagy related 4C cysteine peptidase |
| Synonyms gene: |
AUTL1 APG4C |
| Synonyms gene name: |
AUT (S, AUT-like 1, cerevisiae) APG4 autophagy 4 homolog C (S, cerevisiae) ATG4 autophagy related 4 homolog C (S, cerevisiae) autophagy related 4C, cerevisiae)-like 1, cysteine endopeptidase, cysteine endopeptidase (S, cysteine peptidase |
| Synonyms: |
FLJ14867 AUTL3 |
| Locus: |
1p31, 3 |
| Discovery year: |
2001-07-13 |
| GenBank acession: |
AK027773 |
| Entrez gene record: |
84938 |
| Pubmed identfication: |
12446702 |
| RefSeq identity: |
NM_032852 |
| Classification: |
Autophagy related |
| Havana BLAST/BLAT: |
OTTHUMG00000009142 |