| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
5 kD, 8 |
| UniProt number: |
P02776 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLESHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL4, PF4 (C-6His), C-X-C Motif Chemokine 4 |
| Short name: |
CXCL4, PF4 (C-6His), Recombinant C-X-C Motif Chemokine 4 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CXCL4, platelet factor 4 (C-6His), sapiens C-X-C Motif Chemokine 4, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CXCL4 and PF-4 and SCYB4, CXCR3 chemokine receptor binding, Extracellular, PF4 and IDBG-24097 and ENSG00000163737 and 5196, this GO :0002576 and platelet degranulation and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006955 and immune response and biological process this GO :0007596 and blood coagulation and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0010628 and positive regulation of gene expression and biological process this GO :0010744 and positive regulation of macrophage derived foam cell differentiation and biological process this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030168 and platelet activation and biological process this GO :0030595 and leukocyte chemotaxis and biological process this GO :0030816 and positive regulation of cAMP metabolic process and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043950 and positive regulation of cAMP-mediated signaling and biological process this GO :0045347 and negative regulation of MHC class II biosynthetic process and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045653 and negative regulation of megakaryocyte differentiation and biological process this GO :0045918 and negative regulation of cytolysis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048248 and CXCR3 chemokine receptor binding and molecular function this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0048248 : CXCR3 chemokine receptor binding, this GO :0008201 : heparin binding, this GO :0048248 : CXCR3 chemokine receptor binding, platelet factor 4 |
| Identity: |
8861 |
| Gene: |
PF4 |
More about : PF4 |
| Long gene name: |
platelet factor 4 |
| Synonyms gene name: |
platelet factor 4 |
| Synonyms: |
SCYB4 CXCL4 |
| Synonyms name: |
chemokine (C-X-C motif) ligand 4 |
| Locus: |
4q13, 3 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M25897 |
| Entrez gene record: |
5196 |
| Pubmed identfication: |
3622011 |
| Havana BLAST/BLAT: |
OTTHUMG00000130009 |