| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
7, 8 kD |
| UniProt number: |
P02776 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 8, 2 um filtered solution of 50 mM TrisHCl, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL4, PF4, C-X-C Motif Chemokine 4 |
| Short name: |
CXCL4, PF4, Recombinant C-X-C Motif Chemokine 4 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CXCL4, platelet factor 4, sapiens C-X-C Motif Chemokine 4, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CXCL4 and PF-4 and SCYB4, CXCR3 chemokine receptor binding, Extracellular, PF4 and IDBG-24097 and ENSG00000163737 and 5196, this GO :0002576 and platelet degranulation and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006955 and immune response and biological process this GO :0007596 and blood coagulation and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0010628 and positive regulation of gene expression and biological process this GO :0010744 and positive regulation of macrophage derived foam cell differentiation and biological process this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030168 and platelet activation and biological process this GO :0030595 and leukocyte chemotaxis and biological process this GO :0030816 and positive regulation of cAMP metabolic process and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043950 and positive regulation of cAMP-mediated signaling and biological process this GO :0045347 and negative regulation of MHC class II biosynthetic process and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045653 and negative regulation of megakaryocyte differentiation and biological process this GO :0045918 and negative regulation of cytolysis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048248 and CXCR3 chemokine receptor binding and molecular function this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0048248 : CXCR3 chemokine receptor binding, this GO :0008201 : heparin binding, this GO :0048248 : CXCR3 chemokine receptor binding, platelet factor 4 |
| Identity: |
8861 |
| Gene: |
PF4 |
More about : PF4 |
| Long gene name: |
platelet factor 4 |
| Synonyms gene name: |
platelet factor 4 |
| Synonyms: |
SCYB4 CXCL4 |
| Synonyms name: |
chemokine (C-X-C motif) ligand 4 |
| Locus: |
4q13, 3 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M25897 |
| Entrez gene record: |
5196 |
| Pubmed identfication: |
3622011 |
| Havana BLAST/BLAT: |
OTTHUMG00000130009 |