| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
35 kD, 9 |
| UniProt number: |
P80162 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 5% Trehalose, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKNVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL6 (C-6His), C-X-C Motif Chemokine 6 |
| Short name: |
CXCL6 (C-6His), Recombinant C-X-C Motif Chemokine 6 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
chemokine (C-X-C motif) ligand 6 (C-6His), sapiens C-X-C Motif Chemokine 6, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CKA-3 and GCP-2 and GCP2 and SCYB6, CXCL6 and IDBG-24017 and ENSG00000124875 and 6372, Extracellular, heparin binding, this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0042742 and defense response to bacterium and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding, this GO :0008201 : heparin binding, chemokine (C-X-C motif) ligand 6 |
| Identity: |
10643 |
| Gene: |
CXCL6 |
More about : CXCL6 |
| Long gene name: |
C-X-C motif chemokine ligand 6 |
| Synonyms gene: |
SCYB6 |
| Synonyms gene name: |
member 6 (granulocyte chemotactic protein 2) chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) chemokine (C-X-C motif) ligand 6 , small inducible cytokine subfamily B (Cys-X-Cys) |
| Synonyms: |
GCP-2 CKA-3 |
| Synonyms name: |
granulocyte chemotactic protein 2 |
| Locus: |
4q13, 3 |
| Discovery year: |
1997-10-09 |
| GenBank acession: |
U83303 |
| Entrez gene record: |
6372 |
| Pubmed identfication: |
9465307 |
| RefSeq identity: |
NM_002993 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000130010 |