| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
1 kD, 10 |
| UniProt number: |
P19876 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
(N-6His), CXCL3, GRO&gamma, C-X-C Motif Chemokine 3 |
| Short name: |
(N-6His), CXCL3, GRO&gamma, Recombinant C-X-C Motif Chemokine 3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
(N-6His), GRO&gamma, chemokine (C-X-C motif) ligand 3, sapiens C-X-C Motif Chemokine 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CINC-2b and GRO3 and GROg and MIP-2b and MIP2B and SCYB3, CXCL3 and IDBG-24221 and ENSG00000163734 and 2921, Extracellular, chemokine activity, this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0008009 and chemokine activity and molecular function this GO :0030593 and neutrophil chemotaxis and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity, chemokine (C-X-C motif) ligand 3 |
| Identity: |
4604 |
| Gene: |
CXCL3 |
More about : CXCL3 |
| Long gene name: |
C-X-C motif chemokine ligand 3 |
| Synonyms gene: |
GRO3 |
| Synonyms gene name: |
GRO3 oncogene chemokine (C-X-C motif) ligand 3 |
| Synonyms: |
SCYB3 GROg MIP-2b CINC-2b |
| Locus: |
4q13, 3 |
| Discovery year: |
1991-05-21 |
| GenBank acession: |
M36821 |
| Entrez gene record: |
2921 |
| Pubmed identfication: |
2217207 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000160861 |