| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
8, 9 kD |
| UniProt number: |
P09341 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 5% Trehalose, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSNVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL1 (C-6His), C-X-C Motif Chemokine 1 |
| Short name: |
CXCL1 (C-6His), Recombinant C-X-C Motif Chemokine 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
a) (C-6His), chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, sapiens C-X-C Motif Chemokine 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CXCL1 and IDBG-24070 and ENSG00000163739 and 2919, Extracellular, FSP and GRO1 and GROa and MGSA and MGSA-a and NAP-3 and SCYB1, alpha), growth factor activity, this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008047 and enzyme activator activity and molecular function this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0030036 and actin cytoskeleton organization and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008009 : chemokine activity and also this GO :0008047 : enzyme activator activity and also this GO :0008083 : growth factor activity, this GO :0008009 : chemokine activity, this GO :0008047 : enzyme activator activity, this GO :0008083 : growth factor activity, chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity |
| Identity: |
4602 |
| Gene: |
CXCL1 |
More about : CXCL1 |
| Long gene name: |
C-X-C motif chemokine ligand 1 |
| Synonyms gene: |
MGSA GRO1 FSP |
| Synonyms gene name: |
GRO1 oncogene (melanoma growth stimulating activity, alpha) , alpha) fibroblast secretory protein chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity |
| Synonyms: |
SCYB1 GROa MGSA-a NAP-3 |
| Synonyms name: |
alpha , melanoma growth stimulating activity |
| Locus: |
4q13, 3 |
| Discovery year: |
1988-08-11 |
| GenBank acession: |
J03561 |
| Entrez gene record: |
2919 |
| Pubmed identfication: |
2217207 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000160866 |