| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
36, 6 kD |
| UniProt number: |
P02778 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL10 (C-Fc-6His), C-X-C Motif Chemokine 10 |
| Short name: |
CXCL10 (C-Fc-6His), Recombinant C-X-C Motif Chemokine 10 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
chemokine (C-X-C motif) ligand 10 (C-fragment c-6His), sapiens C-X-C Motif Chemokine 10, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
C7 and crg-2 and gIP-10 and IFI10 and INP10 and IP-10 and mob-1 and SCYB10, CXCL10 and IDBG-25212 and ENSG00000169245 and 3627, CXCL10 and IDBG-643109 and ENSBTAG00000001725 and 615107, CXCR3 chemokine receptor binding, Cxcl10 and IDBG-179916 and ENSMUSG00000034855 and 15945, Extracellular, this GO :0002690 and positive regulation of leukocyte chemotaxis and biological process this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007517 and muscle organ development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008015 and blood circulation and biological process this GO :0008201 and heparin binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008603 and cAMP-dependent protein kinase regulator activity and molecular function this GO :0009306 and protein secretion and biological process this GO :0009409 and response to cold and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010332 and response to gamma radiation and biological process this GO :0010818 and T cell chemotaxis and biological process this GO :0010996 and response to auditory stimulus and biological process this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030816 and positive regulation of cAMP metabolic process and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033280 and response to vitamin D and biological process this GO :0034605 and cellular response to heat and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043950 and positive regulation of cAMP-mediated signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0045859 and regulation of protein kinase activity and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048248 and CXCR3 chemokine receptor binding and molecular function this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0051607 and defense response to virus and biological process this GO :0070098 and chemokine-mediated signaling pathway and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :2000406 and positive regulation of T cell migration and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0008603 : cAMP-dependent protein kinase regulator activity and also this GO :0048248 : CXCR3 chemokine receptor binding, this GO :0005515 : protein binding, this GO :0008009 : chemokine activity, this GO :0008201 : heparin binding, this GO :0008603 : cAMP-dependent protein kinase regulator activity, this GO :0048248 : CXCR3 chemokine receptor binding, chemokine (C-X-C motif) ligand 10 |
| Identity: |
10637 |
| Gene: |
CXCL10 |
More about : CXCL10 |
| Long gene name: |
C-X-C motif chemokine ligand 10 |
| Synonyms gene: |
INP10 SCYB10 |
| Synonyms gene name: |
member 10 chemokine (C-X-C motif) ligand 10 , small inducible cytokine subfamily B (Cys-X-Cys) |
| Synonyms: |
IFI10 IP-10 crg-2 mob-1 C7 gIP-10 |
| Locus: |
4q21, 1 |
| Discovery year: |
1999-12-09 |
| GenBank acession: |
X02530 |
| Entrez gene record: |
3627 |
| Pubmed identfication: |
2437586 3925348 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000160887 |