FE65 Antibody

Contact us
Catalog number: R31784
Price: 1041 €
Supplier: genways
Product name: FE65 Antibody
Quantity: 1 vial
Other quantities: 0.1mg 389€ 0.1ml 263€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: FE65
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the FE65 antibody should be determined by the researcher
Intented use: This FE65 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O00213
Purity: Antigen affinity
Description: Adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain, Associates with chromatin in a region surrounding the CASP4 transcriptional start site(s), Function in association with TSHZ3, Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, May act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), Plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis, Required for histone H4 acetylation at double-strand breaks (DSBs), SET and HDAC factors as a transcriptional repressor, encoding different isoforms have been described for this gene, probably explains its trancription activation activity, recruiting other pro-apoptosis factors such as MAPK8/JNK1, that inhibits the expression of CASP4, APBB1/RIR/FE65 is a transcription coregulator that can have both coactivator and corepressor functions
Immunogen: Amino acids ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE of human FE65 were used as the immunogen for the FE65 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FE65 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membrane, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: FE65
Short name: FE65 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: FE65 (Antibody to)
Alternative technique: antibodies
Identity: 581
Gene: APBB1 | More about : APBB1
Long gene name: amyloid beta precursor protein binding family B member 1
Synonyms gene: RIR
Synonyms gene name: amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
Synonyms: Fe65
Locus: 11p15, 4
Discovery year: 1997-03-27
GenBank acession: L77864
Entrez gene record: 322
Pubmed identfication: 8955346 8894693
RefSeq identity: NM_001164
Havana BLAST/BLAT: OTTHUMG00000165454

Related Products :

GWB-366EC9 Fe65-like protein (APBB2) Rabbit antibody to or anti-Human Polyclonal (aa315-330) antibody 1 x 1 vial 602 € genways human
RA25029-100 anti-APBB1 / FE65 Antibody 0,1 ml 601 € acr human
GENTAUR-58be3e956ee11 Anti- FE65 Antibody 100ug 393 € MBS Polyclonals human
R30161 FE65 Antibody 0.1mg 389 € NJS poly human
R31784 FE65 Antibody 0.1mg 406 € NJS poly human
R34133-100UG FE65 Antibody 0.1mg 406 € NJS poly human
bs-0110R-A350 FE65 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0110R-A488 FE65 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0110R-A555 FE65 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0110R-A594 FE65 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0110R-A647 FE65 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0110R-Biotin FE65 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-0110R FE65 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-0110R-Cy3 FE65 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-0110R-Cy5 FE65 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-0110R-Cy5.5 FE65 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-0110R-Cy7 FE65 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-0110R-FITC FE65 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-0110R-HRP FE65 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS420326 Goat anti-APBB1 / FE65 Antibody 100ug 370 € MBS Polyclonals_1 human
GENTAUR-58be59475a182 Anti-FE65 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
MBS623302 APBB1 (Amyloid beta A4 Precursor Protein-Binding, Family B, Member 1, Fe65, MGC:9072, RIR, Adaptor Protein FE65a2, Stat-like Protein) 100ug 707 € MBS Polyclonals_1 human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human
GWB-B43069 antibody to or anti-Apaf1 (Mouse) Monoclonal antibody , antibody 1 vial 573 € genways mouse
GWB-A68C2D antibody to or anti- Brain-specificity angiogenesis inhibitor 2 antibody to or anti-Human antibody 1 vial 602 € genways human
GWB-6B2DC9 antibody to or anti- Control Immune Serum goat antibody to or anti- peptide sequence Carrier antibody 1 tube 729 € genways human
GWB-BE9688 antibody to or anti- Estrone-6 antibody antibody 1 vial 1041 € genways human