| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
FE65 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the FE65 antibody should be determined by the researcher |
| Intented use: |
This FE65 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O00213 |
| Purity: |
Antigen affinity |
| Description: |
Adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain, Associates with chromatin in a region surrounding the CASP4 transcriptional start site(s), Function in association with TSHZ3, Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, May act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), Plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis, Required for histone H4 acetylation at double-strand breaks (DSBs), SET and HDAC factors as a transcriptional repressor, encoding different isoforms have been described for this gene, probably explains its trancription activation activity, recruiting other pro-apoptosis factors such as MAPK8/JNK1, that inhibits the expression of CASP4, APBB1/RIR/FE65 is a transcription coregulator that can have both coactivator and corepressor functions |
| Immunogen: |
Amino acids ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE of human FE65 were used as the immunogen for the FE65 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FE65 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
FE65 |
| Short name: |
FE65 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
FE65 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
581 |
| Gene: |
APBB1 |
More about : APBB1 |
| Long gene name: |
amyloid beta precursor protein binding family B member 1 |
| Synonyms gene: |
RIR |
| Synonyms gene name: |
amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) |
| Synonyms: |
Fe65 |
| Locus: |
11p15, 4 |
| Discovery year: |
1997-03-27 |
| GenBank acession: |
L77864 |
| Entrez gene record: |
322 |
| Pubmed identfication: |
8955346 8894693 |
| RefSeq identity: |
NM_001164 |
| Havana BLAST/BLAT: |
OTTHUMG00000165454 |