Recombinant Mouse Interleukin-27, IL-27 (C-6His)

Contact us
Catalog number: CS44
Price: 2283 €
Supplier: novo
Product name: Recombinant Mouse Interleukin-27, IL-27 (C-6His)
Quantity: 1 mg
Other quantities: 10 µg 232€ 50 µg 598€ 500 µg 2536€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Phe29-Ser234 is expressed, Recombinant Mouse Interleukin-27 subunit alpha and Interleukin-27 subunit beta is produced by our expression system and the target gene encoding Tyr19-Pro228&
Molecular Weight: 49 kD
UniProt number: O35228&, Q8K3I6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGGGSGGGSGGGSGGGSFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-27 (C-6His), Interleukin-27
Short name: IL-27 (C-6His), Recombinant Mouse Interleukin-27
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Interleukin-27 (C-6His), recombinant Mouse Interleukin-27
Alternative technique: rec
Identity: 5984
Gene: IL17D | More about : IL17D
Long gene name: interleukin 17D
Synonyms: IL-22 IL-27 IL-17D IL27 FLJ30846
Synonyms name: interleukin 27
Locus: 13q12, 11
Discovery year: 2000-05-02
GenBank acession: AY078238
Entrez gene record: 53342
Pubmed identfication: 12097364
RefSeq identity: NM_138284
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000016521

Related Products :

C757 Recombinant Mouse Interleukin-11, IL-11 (C-6His) 500 µg 2283 € novo mouse
CM38 Recombinant Mouse Interleukin-12 Subunit β, IL-12 p40, IL-12B (C-6His) 10 µg 156 € novo human
CD56 Recombinant Mouse Interleukin-13, IL-13 (Pro22-Phe131,C-6His) 500 µg 2217 € novo mouse
CD57 Recombinant Mouse Interleukin-13, IL-13 (Ser26-Phe131,C-6His) 1 mg 3145 € novo mouse
CC11 Recombinant Mouse Interleukin-17F, IL-17F (C-6His) 500 µg 1613 € novo mouse
CJ49 Recombinant Mouse Interleukin-18, IL-18, IL-1F4 (C-6His) 10 µg 100 € novo mouse
CK06 Recombinant Mouse Interleukin-18, IL-18, IL-1F4 (N-6His) 1 mg 2283 € novo mouse
CR07 Recombinant Mouse Interleukin-21, IL-21(N-6His) 1 mg 2486 € novo mouse
CS91 Recombinant Mouse Interleukin-21 Receptor, IL-21R (C-6His) 1 mg 912 € novo mouse
CS44 Recombinant Mouse Interleukin-27, IL-27 (C-6His) 1 mg 3602 € novo mouse
CP39 Recombinant Mouse Interleukin-3, IL-3 (C-6His) 10 µg 202 € novo mouse
CK74 Recombinant Mouse Interleukin-4, IL-4 (C-6His) 50 µg 369 € novo mouse
CC23 Recombinant Mouse Interleukin-5 Receptor Subunit Alpha, IL-5 Rα (C-6His) 500 µg 1613 € novo human
CC73 Recombinant Mouse Interleukin-7, IL-7 (C-6His) 10 µg 202 € novo mouse
CG97 Recombinant Cavia porcellus Interleukin-1 Beta, IL-1 beta (C-6His) 1 mg 2283 € novo human
C027 Recombinant Human Interleukin-10, IL-10 (N-6His) 10 µg 202 € novo human
CC89 Recombinant Human Interleukin-13, IL-13 (C-6His) 500 µg 1613 € novo human
CS32 Recombinant Human Interleukin-13 Receptor Subunit Alpha-1, IL-13RA1(C-6His) 500 µg 659 € novo human
CI60 Recombinant Human Interleukin-17A, F Heterodimer, IL-17A & IL-17F (C-6His) 1 mg 2486 € novo human
C774 Recombinant Human Interleukin-17A, IL-17A (C-6His) 1 mg 2283 € novo human
CK30 Recombinant Human Interleukin-17B, IL-17B (C-6His) 10 µg 156 € novo human
CA22 Recombinant Human Interleukin-17F, IL-17F (C-6His) 50 µg 369 € novo human
CD72 Recombinant Human Interleukin-18, IL-18, IL-1F4 (C-6His) 50 µg 369 € novo human
CD66 Recombinant Human Interleukin-2, IL-2 (C-6His) 50 µg 202 € novo human
CJ40 Recombinant Human Interleukin-23, IL-23 (C-6His) 1 mg 2486 € novo human
C792 Recombinant Human Interleukin-25, IL-25 (C-6His) 10 µg 156 € novo human
CG64 Recombinant Human Interleukin-25, IL25, MYDGF (N-6His) 50 µg 156 € novo human
CB65 Recombinant Human Interleukin-27, IL-27 (C-6His) 10 µg 232 € novo human
CA25 Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3 (C-6His) 1 mg 2283 € novo human
CD90 Recombinant Human Interleukin-3, IL-3 (C-6His) 1 mg 2283 € novo human