Recombinant Mouse Interleukin-18, IL-18, IL-1F4 (N-6His)

Contact us
Catalog number: CK06
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Mouse Interleukin-18, IL-18, IL-1F4 (N-6His)
Quantity: 0.1ml
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-18 is produced by our E, coli expression system and the target gene encoding Asn36-Ser192 is expressed with a 6His tag at the N-terminus
Molecular Weight: 19, 7 kD
UniProt number: P70380
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-18, IL-1F4 (N-6His), Interleukin-18
Short name: IL-18, IL-1F4 (N-6His), Recombinant Mouse Interleukin-18
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Interleukin-18, Interleukin-1F4 (N-6His), recombinant Mouse Interleukin-18
Alternative technique: rec
Identity: 5986
Gene: IL18 | More about : IL18
Long gene name: interleukin 18
Synonyms gene name: interleukin 18 (interferon-gamma-inducing factor)
Synonyms: IGIF IL1F4 IL-1g IL-18
Synonyms name: interferon-gamma-inducing factor
Locus: 11q23, 1
Discovery year: 1997-07-25
GenBank acession: U90434
Entrez gene record: 3606
Pubmed identfication: 7477296 9693051
RefSeq identity: NM_001562
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000167006

Related Products :

CJ49 Recombinant Mouse Interleukin-18, IL-18, IL-1F4 (C-6His) 10 µg 100 € novo mouse
CK06 Recombinant Mouse Interleukin-18, IL-18, IL-1F4 (N-6His) 1 mg 2283 € novo mouse
CD72 Recombinant Human Interleukin-18, IL-18, IL-1F4 (C-6His) 50 µg 369 € novo human
CH29 Recombinant Human Interleukin-18, IL-18, IL-1F4 1 mg 2283 € novo human
YSRTMCA2931Z Annexin V, Mouse Monoclonal antibody-; Clone: 1F4-1A5, WB, Azide Free 0.1 mg Ask price € accurate-monoclonals mouse
APO-000308-M01 ANXA5 Mouse Monoclonal Antibody (M01), clone 1F4-1A5 0.1mg 495 € Zyagen mouse
OBT0138F CD3, Clone: 1F4, Mouse Monoclonal antibody-Rat, FITC 100 tests Ask price € accurate-monoclonals rat
YSRTMCA772FA CD3, Clone: 1F4, Mouse Monoclonal antibody-Rat; flow: FITC 0.05 mg 205 € accurate-monoclonals rat
YSRTMCA772FB CD3, Clone: 1F4, Mouse Monoclonal antibody-Rat; flow: FITC 0.5 mg 704 € accurate-monoclonals rat
OBT0138 CD3, Clone: 1F4, Mouse Monoclonal antibody-Rat; frozen/paraffin, IH/flow/IP 200ug Ask price € accurate-monoclonals rat
YSRTMCA772PB CD3, Mouse Monoclonal antibody-Rat; Clone: 1F4, Pacific Blue conj. 1000ul Ask price € accurate-monoclonals rat
YSRTMCA772A647 CD3, T-Cell (mature), Thymocyte, Clone: 1F4, Mouse Monoclonal antibody-Rat, ALEXA 647 conj. vial Ask price € accurate-monoclonals rat
YSRTMCA772A700 CD3, T-Cell (mature), Thymocyte, Clone: 1F4, Mouse Monoclonal antibody-Rat, ALEXA 647 conj. vial Ask price € accurate-monoclonals rat
YSRTMCA772XZ CD3, T-Cell (mature), Thymocyte, Clone: 1F4, Mouse Monoclonal antibody-Rat, azide-free; frozen/paraffin (pretreat), IH/IP/flow 1 mg 1059 € accurate-monoclonals rat
YSRTMCA772B CD3, T-Cell (mature), Thymocyte, Clone: 1F4, Mouse Monoclonal antibody-Rat, Biotin; flow 0.1 mg 304 € accurate-monoclonals rat
YSRTMCA772F CD3, T-Cell (mature), Thymocyte, Clone: 1F4, Mouse Monoclonal antibody-Rat, FITC; flow 0.1 mg 339 € accurate-monoclonals rat
YSRTMCA772 CD3, T-Cell (mature), Thymocyte, Clone: 1F4, Mouse Monoclonal antibody-Rat; frozen/paraffin (pretreat), IH/IP/flow 200ug 304 € accurate-monoclonals rat
YSRTMCA772GA CD3, T-Cell (mature), Thymocyte, Clone: 1F4, Mouse Monoclonal antibody-Rat; frozen/paraffin (pretreat), IH/IP/flow 0.1 mg 190 € accurate-monoclonals rat
YSRTMCA3350Z Cyclophilin A, Mouse Monoclonal antibody-; Clone: 1F4-1B5 0.1 mg Ask price € accurate-monoclonals mouse
YSRTMCA3042Z Decorin, Mouse Monoclonal antibody-; Clone: 3H4-1F4 0.1 mg Ask price € accurate-monoclonals mouse
GENTAUR-58bde81b0a7a5 Mouse Monoclonal [clone 1F4-1A5] (IgG1,k) to Human ANXA5 / Annexin V Antibody 50ug 663 € MBS mono human
GENTAUR-58bde7830302a Mouse Monoclonal [clone 3H4-1F4] (IgG2b,k) to Human DCN / Decorin Antibody 50ug 663 € MBS mono human
TRA-079858-M01 NEK11 Mouse Monoclonal Antibody (M01), clone 4E1-1F4 0.1mg 495 € Zyagen mouse
YSRTMCA5459Z PAPSS1, Mouse Monoclonal antibody-; Clone: 1F4 0.1 mg Ask price € accurate-monoclonals mouse
YSRTMCA4139Z RPA3, Mouse Monoclonal antibody-; Clone: 1F4 0.1 mg Ask price € accurate-monoclonals mouse
CEL-006119-M01 RPA3 Mouse Monoclonal Antibody (M01), clone 1F4 0.1mg 495 € Zyagen mouse
YSRTMCA5448Z ST3GAL4, Mouse Monoclonal antibody-; Clone: 1F4 0.1 mg Ask price € accurate-monoclonals mouse
GENTAUR-58be67fc65b9d Anti-beta-Amyloid (1-42) (1F4) Monoclonal, ALEXA Fluor 594 100 microliters 489 € Bioss Monoclonal Antibodies human
bsm-0107M-Biotin beta-Amyloid (1-42) (1F4) Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bsm-0107M-Cy3 beta-Amyloid (1-42) (1F4) Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human