Recombinant Mouse Interleukin-21, IL-21(N-6His)

Contact us
Catalog number: CR07
Price: 2283 €
Supplier: novo
Product name: Recombinant Mouse Interleukin-21, IL-21(N-6His)
Quantity: 1 mg
Other quantities: 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-21 is produced by our E, coli expression system and the target gene encoding Pro25-Ser146 is expressed with a 6His tag at the N-terminus
Molecular Weight: 14, 4 kD
UniProt number: Q9ES17
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-21(N-6His), Interleukin-21
Short name: IL-21(N-6His), Recombinant Mouse Interleukin-21
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Interleukin-21(N-6His), recombinant Mouse Interleukin-21
Alternative technique: rec
Identity: 6005
Gene: IL21 | More about : IL21
Long gene name: interleukin 21
Synonyms: Za11 IL-21
Locus: 4q27
Discovery year: 2000-03-29
GenBank acession: AF254069
Entrez gene record: 59067
Pubmed identfication: 11081504 17947662
RefSeq identity: NM_021803
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000133073

Related Products :

CR07 Recombinant Mouse Interleukin-21, IL-21(N-6His) 1 mg 2486 € novo mouse
GWB-DAE604 antibody to or anti- c-erbB-2/HER-2/neu Ab-1 (21N) antibody 1 vial 1272 € genways human
C757 Recombinant Mouse Interleukin-11, IL-11 (C-6His) 500 µg 2283 € novo mouse
CM38 Recombinant Mouse Interleukin-12 Subunit β, IL-12 p40, IL-12B (C-6His) 10 µg 156 € novo human
CD56 Recombinant Mouse Interleukin-13, IL-13 (Pro22-Phe131,C-6His) 500 µg 2217 € novo mouse
CD57 Recombinant Mouse Interleukin-13, IL-13 (Ser26-Phe131,C-6His) 1 mg 3145 € novo mouse
CC11 Recombinant Mouse Interleukin-17F, IL-17F (C-6His) 500 µg 1613 € novo mouse
CJ49 Recombinant Mouse Interleukin-18, IL-18, IL-1F4 (C-6His) 10 µg 100 € novo mouse
CK06 Recombinant Mouse Interleukin-18, IL-18, IL-1F4 (N-6His) 1 mg 2283 € novo mouse
CS91 Recombinant Mouse Interleukin-21 Receptor, IL-21R (C-6His) 1 mg 912 € novo mouse
CS44 Recombinant Mouse Interleukin-27, IL-27 (C-6His) 1 mg 3602 € novo mouse
CP39 Recombinant Mouse Interleukin-3, IL-3 (C-6His) 10 µg 202 € novo mouse
CK74 Recombinant Mouse Interleukin-4, IL-4 (C-6His) 50 µg 369 € novo mouse
CC23 Recombinant Mouse Interleukin-5 Receptor Subunit Alpha, IL-5 Rα (C-6His) 500 µg 1613 € novo human
CC73 Recombinant Mouse Interleukin-7, IL-7 (C-6His) 10 µg 202 € novo mouse
CG97 Recombinant Cavia porcellus Interleukin-1 Beta, IL-1 beta (C-6His) 1 mg 2283 € novo human
C027 Recombinant Human Interleukin-10, IL-10 (N-6His) 10 µg 202 € novo human
CC89 Recombinant Human Interleukin-13, IL-13 (C-6His) 500 µg 1613 € novo human
CS32 Recombinant Human Interleukin-13 Receptor Subunit Alpha-1, IL-13RA1(C-6His) 500 µg 659 € novo human
CI60 Recombinant Human Interleukin-17A, F Heterodimer, IL-17A & IL-17F (C-6His) 1 mg 2486 € novo human
C774 Recombinant Human Interleukin-17A, IL-17A (C-6His) 1 mg 2283 € novo human
CK30 Recombinant Human Interleukin-17B, IL-17B (C-6His) 10 µg 156 € novo human
CA22 Recombinant Human Interleukin-17F, IL-17F (C-6His) 50 µg 369 € novo human
CD72 Recombinant Human Interleukin-18, IL-18, IL-1F4 (C-6His) 50 µg 369 € novo human
CD66 Recombinant Human Interleukin-2, IL-2 (C-6His) 50 µg 202 € novo human
CJ40 Recombinant Human Interleukin-23, IL-23 (C-6His) 1 mg 2486 € novo human
C792 Recombinant Human Interleukin-25, IL-25 (C-6His) 10 µg 156 € novo human
CG64 Recombinant Human Interleukin-25, IL25, MYDGF (N-6His) 50 µg 156 € novo human
CB65 Recombinant Human Interleukin-27, IL-27 (C-6His) 10 µg 232 € novo human
CA25 Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3 (C-6His) 1 mg 2283 € novo human