| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human SF20 is produced by our E, coli expression system and the target gene encoding Ser33-Leu173 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
18 kD |
| UniProt number: |
Q969H8 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 20 mM PB，150 mM sodium chloride, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
IL25, MYDGF (N-6His), Interleukin-25 |
| Short name: |
IL25, MYDGF (N-6His), Recombinant Interleukin-25 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
MYDGF (N-6His), interleukin 25, sapiens Interleukin-25, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, IL25 and IDBG-3218 and ENSG00000166090 and 64806, IL25 and IDBG-645820 and ENSBTAG00000009701 and 526816, Il25 and IDBG-162540 and ENSMUSG00000040770 and 140806, interleukin-17E receptor binding, this GO :0002437 and inflammatory response to antigenic stimulus and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006954 and inflammatory response and biological process this GO :0008150 and biological process and biological process this GO :0009620 and response to fungus and biological process this GO :0009624 and response to nematode and biological process this GO :0030222 and eosinophil differentiation and biological process this GO :0030380 and interleukin-17E receptor binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0030380 : interleukin-17E receptor binding, this GO :0030380 : interleukin-17E receptor binding, interleukin 25 |
| Identity: |
16948 |
| Gene: |
MYDGF |
More about : MYDGF |
| Long gene name: |
myeloid derived growth factor |
| Synonyms gene: |
IL27 IL27w C19orf10 |
| Synonyms gene name: |
interleukin 27 working designation chromosome 19 open reading frame 10 |
| Synonyms: |
R33729_1 IL25 SF20 IL-25 IL-27 |
| Locus: |
19p13, 3 |
| Discovery year: |
2002-04-03 |
| GenBank acession: |
AF282264 |
| Entrez gene record: |
56005 |
| Pubmed identfication: |
17362502 21128247 25581518 |
| RefSeq identity: |
NM_019107 |