| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Ile23-Ser328 is expressed with a 6His tag at the C-terminus, Recombinant Human Interleukin-23 is produced by our Mammalian expression system and the target gene encoding Arg20-Pro189& |
| Molecular Weight: |
4 kD, 54 |
| UniProt number: |
P29460, Q9NPF7 & |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline pH7, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS, RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPVDHHHHHH& |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
IL-23 (C-6His), Interleukin-23 |
| Short name: |
IL-23 (C-6His), Recombinant Interleukin-23 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Interleukin-23 (C-6His), sapiens Interleukin-23, recombinant H |
| Alternative technique: |
rec |
| Identity: |
15488 |
| Gene: |
IL23A |
More about : IL23A |
| Long gene name: |
interleukin 23 subunit alpha |
| Synonyms gene name: |
alpha subunit p19 , interleukin 23 |
| Synonyms: |
SGRF IL23P19 IL-23 IL-23A P19 |
| Synonyms name: |
G-CSF related factor , interleukin-six |
| Locus: |
12q13, 3 |
| Discovery year: |
2001-04-10 |
| GenBank acession: |
AB030000 |
| Entrez gene record: |
51561 |
| Pubmed identfication: |
11114383 |
| RefSeq identity: |
NM_016584 |
| Classification: |
Interleukins |
| Havana BLAST/BLAT: |
OTTHUMG00000187402 |