Recombinant Mouse BMP Receptor IA, ALK-3, CD292 (C-Fc-6His)

Contact us
Catalog number: CJ03
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Mouse BMP Receptor IA, ALK-3, CD292 (C-Fc-6His)
Quantity: bulk
Other quantities: 1 mg 1115€ 10 µg 100€ 50 µg 156€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Mouse BMP Receptor IA is produced by our Mammalian expression system and the target gene encoding Gln24-Arg152 is expressed with a Fc
Molecular Weight: 2 kD, 42
UniProt number: P36895
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: ALK-3, CD292 (C-Fc-6His), BMP Receptor IA
Short name: ALK-3, CD292 (C-Fc-6His), Recombinant Mouse BMP Receptor IA
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD292 (C-fragment c-6His), anaplastic lymphoma receptor tyrosine kinase-3, recombinant Mouse BMP Receptor IA
Alternative technique: rec
Alternative to gene target: ALK and IDBG-42084 and ENSG00000171094 and 238, ALK and IDBG-636042 and ENSBTAG00000007379 and 536642, Alk and IDBG-197259 and ENSMUSG00000055471 and 11682, CD246 and NBLST3, Plasma membranes, this GO :0000187 and activation of MAPK activity and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004704 and NF-kappaB-inducing kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004714 and transmembrane receptor protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0016310 and phosphorylation and biological process this GO :0016772 and transferase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004704 : NF-kappaB-inducing kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004714 : transmembrane receptor protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004704 : NF-kappaB-inducing kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004714 : transmembrane receptor protein tyrosine kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016772 : transferase activity, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and molecular function this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0038061 and NIK/NF-kappaB signaling and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043234 and protein complex and cellular component this GO :0046777 and protein autophosphorylation and biological process this GO :0048666 and neuron development and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, anaplastic lymphoma receptor tyrosine kinase
Identity: 1076
Gene: BMPR1A | More about : BMPR1A
Long gene name: bone morphogenetic protein receptor type 1A
Synonyms gene: ACVRLK3
Synonyms gene name: bone morphogenetic protein receptor, type IA
Synonyms: ALK3 CD292
Locus: 10q23, 2
Discovery year: 1994-12-12
GenBank acession: BC028383
Entrez gene record: 657
Pubmed identfication: 8397373 9730621
RefSeq identity: NM_004329
Classification: Type 1 receptor serine/threonine kinases CD molecules
Havana BLAST/BLAT: OTTHUMG00000018657
Locus Specific Databases: LRG_298

Related Products :

CJ03 Recombinant Mouse BMP Receptor IA, ALK-3, CD292 (C-Fc-6His) 500 µg 709 € novo mouse
CD59 Recombinant Human BMP Receptor IA, ALK-3, CD292 (C-Fc-6His) 1 mg 1674 € novo human
RP-0146H Recombinant Human BMPRIA / ALK-3 / CD292 Protein (His & Fc Tag) 100μg 659 € adv human
RP-0145H Recombinant Human BMPRIA / ALK-3 / CD292 Protein (His Tag) 100μg 659 € adv human
MBS614341 Bone Morphogenic Protein Receptor 1A (CD292, BMPR-1A, Bone Morphogenetic Protein Receptor Type IA, Serine Threonine Protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, ACVRLK3) 100ug 735 € MBS Polyclonals_1 human
C303 Recombinant Human BMP Receptor II, BMPR2, PPH1 (C-6His) 10 µg 100 € novo human
CD22 Recombinant Human BMP Receptor II, BMPR2, PPH1 (C-Fc-6His) 1 mg 912 € novo human
MBS624210 Bmp3, NT (Bone Morphogenetic Protein 3, BMP-3, Bone Morphogenetic Protein 3A, BMP-3A, BMP3A, Osteogenin) Antibody 200ul 603 € MBS Polyclonals_1 human
CA76 Recombinant Human Activin Receptor 1A, Activin RI, ALK-2, ACVR1 (C-6His) 10 µg 100 € novo human
CA60 Recombinant Human Activin Receptor 1B, Activin RIB, ALK-4, ACVR1B (C-6His) 500 µg 709 € novo human
CK38 Recombinant Human Bone Morphogenetic Protein 9, BMP-9, GDF-2 (C-6His) 10 µg 202 € novo human
MBS623902 ACVR1, NT (Activin Receptor Type 1, Activin Receptor Type I, ACTR-I, Serine/Threonine-protein Kinase Receptor R1, SKR1, Activin Receptor-like Kinase 2, ALK-2, TGF-B Superfamily Receptor Type I, TSR-I, ACVRLK2) Antibody 200ul 603 € MBS Polyclonals_1 human
abx161306 Anti-CD292 Blocking Peptide inquire 50 € abbex human
BB-PA2016 anti-CD292 / BMPR1A Antibody 0,1 mg 471 € acr human
DA3521 anti-CD292 / BMPR1A Antibody 0,1 mg 529 € acr human
AP11858PU-N anti-CD292 / BMPR1A (Center) Antibody 0,4 ml 587 € acr human
AP11855PU-N anti-CD292 / BMPR1A (N-term) Antibody 0,4 ml 587 € acr human
AP11857PU-N anti-CD292 / BMPR1A (N-term) Antibody 0,4 ml 587 € acr human
AP11859PU-N anti-CD292 / BMPR1A (N-term) Antibody 0,4 ml 587 € acr human
AP11860PU-N anti-CD292 / BMPR1A (N-term) Antibody 0,4 ml 587 € acr human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
CM15 Recombinant Mouse Activin Receptor IB, Activin RIB, ALK-4, ACVR1B (C-Fc) 1 mg 1877 € novo mouse
CK71 Recombinant Mouse Activin Receptor-like Kinase 1, ALK-1, ACVRL1 (C-Fc) 50 µg 141 € novo mouse
CM42 Recombinant Mouse Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 10 µg 126 € novo mouse
MBS622505 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Ox-1-R, Ox1-R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) Antibody 100ug 652 € MBS Polyclonals_1 human
C632 Recombinant Human Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 1 mg 2283 € novo human
abx166906 Anti-BMP And Activin Membrane Bound Inhibitor Homolog Protein (Recombinant) 100 μg 847 € abbex human
abx166952 Anti-BMP Binding Endothelial Regulator Protein (Recombinant) 100 μg 847 € abbex human
abx168344 Anti-BMP Binding Endothelial Regulator Protein (Recombinant) 100 μg 833 € abbex human
GWB-P0432C BMP-2 (active), 283-396aa, Recombinant Protein bulk Ask price € genways bulk human