| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Activin Receptor IB is produced by our Mammalian expression system and the target gene encoding Ser24-Glu126 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
12, 46 kD |
| UniProt number: |
P36896 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ACVR1B (C-6His), ALK-4, Activin RIB, Activin Receptor 1B |
| Short name: |
ACVR1B (C-6His), ALK-4, Activin RIB, Recombinant Activin Receptor 1B |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Activin RIB, activin A receptor, anaplastic lymphoma receptor tyrosine kinase-4, classification IB (C-6His), sapiens Activin Receptor 1B, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ACTRIB and ACVRLK4 and ALK4 and SKR2, ACVR1B and IDBG-33695 and ENSG00000135503 and 91, ACVR1B and IDBG-632110 and ENSBTAG00000013555 and 539315, ALK and IDBG-42084 and ENSG00000171094 and 238, ALK and IDBG-636042 and ENSBTAG00000007379 and 536642, Acvr1b and IDBG-185560 and ENSMUSG00000000532 and 11479, Alk and IDBG-197259 and ENSMUSG00000055471 and 11682, CD246 and NBLST3, Cell surfaces, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007178 and transmembrane receptor protein serine/threonine kinase signaling pathway and biological process this GO :0007417 and central nervous system development and biological process this GO :0009966 and regulation of signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0016020 and membrane and cellular component this GO :0016361 and activin receptor activity, Plasma membranes, activin receptor activity, anaplastic lymphoma receptor tyrosine kinase, this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001942 and hair follicle development and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006355 and regulation of transcription, this GO :0000187 and activation of MAPK activity and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004704 and NF-kappaB-inducing kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004714 and transmembrane receptor protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0016310 and phosphorylation and biological process this GO :0016772 and transferase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005024 : transforming growth factor beta-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016361 : activin receptor activity, this GO :0004672 : protein kinase activity and also this GO :0004704 : NF-kappaB-inducing kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004714 : transmembrane receptor protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0004704 : NF-kappaB-inducing kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004714 : transmembrane receptor protein tyrosine kinase activity, this GO :0005024 : transforming growth factor beta-activated receptor activity, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005524 : ATP binding, this GO :0016361 : activin receptor activity, this GO :0016772 : transferase activity, this GO :0016772 : transferase activity, this GO :0017002 : activin-activated receptor activity, this GO :0019838 : growth factor binding, this GO :0031625 : ubiquitin protein ligase binding, this GO :0034711 : inhibin binding, this GO :0046332 : SMAD binding, this GO :0046872 : metal ion binding, this GO :0048185 : activin binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0017002 : activin-activated receptor activity and also this GO :0019838 : growth factor binding and also this GO :0031625 : ubiquitin protein ligase binding and also this GO :0034711 : inhibin binding and also this GO :0046332 : SMAD binding and also this GO :0046872 : metal ion binding and also this GO :0048185 : activin binding, transferring phosphorus-containing groups and molecular function this GO :0017002 and activin-activated receptor activity and molecular function this GO :0018107 and peptidyl-threonine phosphorylation and biological process this GO :0019838 and growth factor binding and molecular function this GO :0030308 and negative regulation of cell growth and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032924 and activin receptor signaling pathway and biological process this GO :0032927 and positive regulation of activin receptor signaling pathway and biological process this GO :0034711 and inhibin binding and molecular function this GO :0038092 and nodal signaling pathway and biological process this GO :0045648 and positive regulation of erythrocyte differentiation and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046545 and development of primary female sexual characteristics and biological process this GO :0046777 and protein autophosphorylation and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048185 and activin binding and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :1901165 and positive regulation of trophoblast cell migration and biological process, transferring phosphorus-containing groups and molecular function this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0038061 and NIK/NF-kappaB signaling and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043234 and protein complex and cellular component this GO :0046777 and protein autophosphorylation and biological process this GO :0048666 and neuron development and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, type I, type I and also this GO :0016772 : transferase activity, type I and molecular function this GO :0016772 and transferase activity, type IB, activin A receptor |
| Identity: |
172 |
| Gene: |
ACVR1B |
More about : ACVR1B |
| Long gene name: |
activin A receptor type 1B |
| Synonyms gene: |
ACVRLK4 |
| Synonyms gene name: |
activin A receptor, type IB |
| Synonyms: |
ALK4 SKR2 ActRIB |
| Locus: |
12q13, 13 |
| Discovery year: |
1994-12-12 |
| Entrez gene record: |
91 |
| Pubmed identfication: |
8397373 |
| RefSeq identity: |
NM_020328 |
| Classification: |
Type 1 receptor serine/threonine kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000167920 |