| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human BMP Receptor II is produced by our Mammalian expression system and the target gene encoding Ser27-Ile151 is expressed with a Fc |
| Molecular Weight: |
41, 9 kD |
| UniProt number: |
Q13873 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BMPR2, PPH1 (C-Fc-6His), BMP Receptor II |
| Short name: |
BMPR2, PPH1 (C-Fc-6His), Recombinant BMP Receptor II |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
PPH1 (C-fragment c-6His), bone morphogenetic protein receptor, classification II (serine/threonine kinase), sapiens BMP Receptor II, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BMPR-II and BMPR3 and BMR2 and BRK-3 and POVD1 and PPH1 and T-ALK, BMPR2 and IDBG-78880 and ENSG00000204217 and 659, BT, Bmpr2 and IDBG-158574 and ENSMUSG00000067336 and 12168, Extracellular, activin receptor activity, this GO :0001707 and mesoderm formation and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0001946 and lymphangiogenesis and biological process this GO :0001974 and blood vessel remodeling and biological process this GO :0002063 and chondrocyte development and biological process this GO :0003085 and negative regulation of systemic arterial blood pressure and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005901 and caveola and cellular component this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0007178 and transmembrane receptor protein serine/threonine kinase signaling pathway and biological process this GO :0007420 and brain development and biological process this GO :0009267 and cellular response to starvation and biological process this GO :0009925 and basal plasma membrane and cellular component this GO :0009952 and anterior/posterior pattern specification and biological process this GO :0009986 and cell surface and cellular component this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0010634 and positive regulation of epithelial cell migration and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0014916 and regulation of lung blood pressure and biological process this GO :0016020 and membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0016362 and activin receptor activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005024 : transforming growth factor beta-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016362 : activin receptor activity, this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0005024 : transforming growth factor beta-activated receptor activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016362 : activin receptor activity, this GO :0016772 : transferase activity, this GO :0019838 : growth factor binding, this GO :0046872 : metal ion binding, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0019838 : growth factor binding and also this GO :0046872 : metal ion binding, transferring phosphorus-containing groups and molecular function this GO :0019838 and growth factor binding and molecular function this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030425 and dendrite and cellular component this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030509 and BMP signaling pathway and biological process this GO :0030513 and positive regulation of BMP signaling pathway and biological process this GO :0032924 and activin receptor signaling pathway and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0044214 and fully spanning plasma membrane and cellular component this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0045906 and negative regulation of vasoconstriction and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048010 and vascular endothelial growth factor receptor signaling pathway and biological process this GO :0048286 and lung alveolus development and biological process this GO :0048842 and positive regulation of axon extension involved in axon guidance and biological process this GO :0060041 and retina development in camera-type eye and biological process this GO :0060173 and limb development and biological process this GO :0060836 and lymphatic endothelial cell differentiation and biological process this GO :0060840 and artery development and biological process this GO :0060841 and venous blood vessel development and biological process this GO :0061298 and retina vasculature development in camera-type eye and biological process this GO :1902731 and negative regulation of chondrocyte proliferation and biological process this GO :2000279 and negative regulation of DNA biosynthetic process and biological process, type II, type II (serine/threonine kinase), type II and also this GO :0016772 : transferase activity, type II and molecular function this GO :0016772 and transferase activity, 25715 and IDBG-643309 and ENSBTAG00000006420 and 407127, bone morphogenetic protein receptor |
| Identity: |
1078 |
| Gene: |
BMPR2 |
More about : BMPR2 |
| Long gene name: |
bone morphogenetic protein receptor type 2 |
| Synonyms gene: |
PPH1 |
| Synonyms gene name: |
primary pulmonary hypertension 1 bone morphogenetic protein receptor, type II (serine/threonine kinase) bone morphogenetic protein receptor type II |
| Synonyms: |
BRK-3 T-ALK BMPR3 BMPR-II |
| Locus: |
2q33, 1-q33, 2 |
| Discovery year: |
1997-03-19 |
| GenBank acession: |
Z48923 |
| Entrez gene record: |
659 |
| Pubmed identfication: |
7791754 |
| RefSeq identity: |
NM_001204 |
| Classification: |
Type 2 receptor serine/threonine kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000133617 |
| Locus Specific Databases: |
LRG_712 |