| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Activin Receptor IA is produced by our Mammalian expression system and the target gene encoding Met21-Val124 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
12, 6 kD |
| UniProt number: |
Q04771 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ACVR1 (C-6His), ALK-2, Activin RI, Activin Receptor 1A |
| Short name: |
ACVR1 (C-6His), ALK-2, Activin RI, Recombinant Activin Receptor 1A |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Activin RI, activin A receptor, anaplastic lymphoma receptor tyrosine kinase-2, classification I (C-6His), sapiens Activin Receptor 1A, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ACTRI and ACVR1A and ACVRLK2 and ALK2 and FOP and SKR1 and TSRI, ACVR1 and IDBG-641620 and ENSBTAG00000011909 and 338068, ACVR1 and IDBG-72930 and ENSG00000115170 and 90, ALK and IDBG-42084 and ENSG00000171094 and 238, ALK and IDBG-636042 and ENSBTAG00000007379 and 536642, Acvr1 and IDBG-172102 and ENSMUSG00000026836 and 11477, Alk and IDBG-197259 and ENSMUSG00000055471 and 11682, CD246 and NBLST3, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :0048179 and activin receptor complex and cellular component this GO :0048185 and activin binding and molecular function this GO :0048641 and regulation of skeletal muscle tissue development and biological process this GO :0050431 and transforming growth factor beta binding and molecular function this GO :0051145 and smooth muscle cell differentiation and biological process this GO :0060037 and pharyngeal system development and biological process this GO :0060389 and pathway-restricted SMAD protein phosphorylation and biological process this GO :0060923 and cardiac muscle cell fate commitment and biological process this GO :0061445 and endocardial cushion cell fate commitment and biological process this GO :0071385 and cellular response to glucocorticoid stimulus and biological process this GO :2000017 and positive regulation of determination of dorsal identity and biological process this GO :2001237 and negative regulation of extrinsic apoptotic signaling pathway and biological process, Plasma membranes, Plasma membranes, activin A receptor, this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0001569 and patterning of blood vessels and biological process this GO :0001655 and urogenital system development and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001702 and gastrulation with mouth forming second and biological process this GO :0001707 and mesoderm formation and biological process this GO :0001755 and neural crest cell migration and biological process this GO :0002526 and acute inflammatory response and biological process this GO :0003143 and embryonic heart tube morphogenesis and biological process this GO :0003183 and mitral valve morphogenesis and biological process this GO :0003289 and atrial septum primum morphogenesis and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005025 and transforming growth factor beta receptor activity, this GO :0000187 and activation of MAPK activity and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004704 and NF-kappaB-inducing kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004714 and transmembrane receptor protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0016310 and phosphorylation and biological process this GO :0016772 and transferase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005024 : transforming growth factor beta-activated receptor activity and also this GO :0005025 : transforming growth factor beta receptor activity, this GO :0004672 : protein kinase activity and also this GO :0004704 : NF-kappaB-inducing kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004714 : transmembrane receptor protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0004704 : NF-kappaB-inducing kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004714 : transmembrane receptor protein tyrosine kinase activity, this GO :0005024 : transforming growth factor beta-activated receptor activity, this GO :0005025 : transforming growth factor beta receptor activity, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005524 : ATP binding, this GO :0016361 : activin receptor activity, this GO :0016772 : transferase activity, this GO :0016772 : transferase activity, this GO :0017046 : peptide hormone binding, this GO :0019838 : growth factor binding, this GO :0042803 : protein homodimerization activity, this GO :0046332 : SMAD binding, this GO :0046872 : metal ion binding, this GO :0048185 : activin binding, this GO :0050431 : transforming growth factor beta binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0017046 : peptide hormone binding and also this GO :0019838 : growth factor binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046332 : SMAD binding and also this GO :0046872 : metal ion binding and also this GO :0048185 : activin binding and also this GO :0050431 : transforming growth factor beta binding, transferring phosphorus-containing groups and molecular function this GO :0017046 and peptide hormone binding and molecular function this GO :0018107 and peptidyl-threonine phosphorylation and biological process this GO :0019838 and growth factor binding and molecular function this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030278 and regulation of ossification and biological process this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030509 and BMP signaling pathway and biological process this GO :0032924 and activin receptor signaling pathway and biological process this GO :0032926 and negative regulation of activin receptor signaling pathway and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045177 and apical part of cell and cellular component this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0045893 and positive regulation of transcription, transferring phosphorus-containing groups and molecular function this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0038061 and NIK/NF-kappaB signaling and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043234 and protein complex and cellular component this GO :0046777 and protein autophosphorylation and biological process this GO :0048666 and neuron development and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, transforming growth factor beta receptor activity, type I, type I, type I, type I and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016361 : activin receptor activity, type I and also this GO :0016772 : transferase activity, type I and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007178 and transmembrane receptor protein serine/threonine kinase signaling pathway and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007281 and germ cell development and biological process this GO :0007368 and determination of left/right symmetry and biological process this GO :0007369 and gastrulation and biological process this GO :0007498 and mesoderm development and biological process this GO :0007507 and heart development and biological process this GO :0009968 and negative regulation of signal transduction and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0016020 and membrane and cellular component this GO :0016361 and activin receptor activity, type I and molecular function this GO :0016772 and transferase activity, anaplastic lymphoma receptor tyrosine kinase |
| Identity: |
171 |
| Gene: |
ACVR1 |
More about : ACVR1 |
| Long gene name: |
activin A receptor type 1 |
| Synonyms gene: |
ACVRLK2 |
| Synonyms gene name: |
activin A receptor, type I |
| Synonyms: |
SKR1 ALK2 ACVR1A |
| Locus: |
2q24, 1 |
| Discovery year: |
1994-01-10 |
| Entrez gene record: |
90 |
| Pubmed identfication: |
8397373 |
| RefSeq identity: |
NM_001105 |
| Classification: |
Type 1 receptor serine/threonine kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000131967 |