| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Mouse BMP Receptor IA is produced by our Mammalian expression system and the target gene encoding Gln24-Arg152 is expressed with a Fc |
| Molecular Weight: |
2 kD, 42 |
| UniProt number: |
P36895 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
ALK-3, CD292 (C-Fc-6His), BMP Receptor IA |
| Short name: |
ALK-3, CD292 (C-Fc-6His), Recombinant Mouse BMP Receptor IA |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD292 (C-fragment c-6His), anaplastic lymphoma receptor tyrosine kinase-3, recombinant Mouse BMP Receptor IA |
| Alternative technique: |
rec |
| Alternative to gene target: |
ALK and IDBG-42084 and ENSG00000171094 and 238, ALK and IDBG-636042 and ENSBTAG00000007379 and 536642, Alk and IDBG-197259 and ENSMUSG00000055471 and 11682, CD246 and NBLST3, Plasma membranes, this GO :0000187 and activation of MAPK activity and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004704 and NF-kappaB-inducing kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004714 and transmembrane receptor protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0016310 and phosphorylation and biological process this GO :0016772 and transferase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004704 : NF-kappaB-inducing kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004714 : transmembrane receptor protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004704 : NF-kappaB-inducing kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004714 : transmembrane receptor protein tyrosine kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016772 : transferase activity, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and molecular function this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0038061 and NIK/NF-kappaB signaling and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043234 and protein complex and cellular component this GO :0046777 and protein autophosphorylation and biological process this GO :0048666 and neuron development and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, anaplastic lymphoma receptor tyrosine kinase |
| Identity: |
1076 |
| Gene: |
BMPR1A |
More about : BMPR1A |
| Long gene name: |
bone morphogenetic protein receptor type 1A |
| Synonyms gene: |
ACVRLK3 |
| Synonyms gene name: |
bone morphogenetic protein receptor, type IA |
| Synonyms: |
ALK3 CD292 |
| Locus: |
10q23, 2 |
| Discovery year: |
1994-12-12 |
| GenBank acession: |
BC028383 |
| Entrez gene record: |
657 |
| Pubmed identfication: |
8397373 9730621 |
| RefSeq identity: |
NM_004329 |
| Classification: |
Type 1 receptor serine/threonine kinases CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000018657 |
| Locus Specific Databases: |
LRG_298 |