| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
12, 3 kD |
| UniProt number: |
P18340 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 20 mM Tris, 200 mM sodium chloride, 3, Lyophilized from a 0, pH8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH4O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to斯㉠쓐㍂ፀ㢄Å, Always centrifuge tubes before opening, _x005F_x0007__x005F_x0013_耀ؿ_x005F_x0016__x005F_x0017__x005F_x0013_耀, g/ml, _x005F_x0013__x005F_x0002_㉠㢄Å |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MTLVIRNARCSCISTSRGTVHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CXCL9, C-X-C Motif Chemokine 9 |
| Short name: |
CXCL9, Recombinant Mouse C-X-C Motif Chemokine 9 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
chemokine (C-X-C motif) ligand 9, recombinant Mouse C-X-C Motif Chemokine 9 |
| Alternative technique: |
rec |
| Alternative to gene target: |
CMK and crg-10 and Humig and MIG and SCYB9, CXCL9 and IDBG-25111 and ENSG00000138755 and 4283, CXCL9 and IDBG-643104 and ENSBTAG00000038639 and 513990, CXCR3 chemokine receptor binding, Cxcl9 and IDBG-179870 and ENSMUSG00000029417 and 17329, Extracellular, this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006952 and defense response and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006968 and cellular defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0009897 and external side of plasma membrane and cellular component this GO :0030816 and positive regulation of cAMP metabolic process and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043950 and positive regulation of cAMP-mediated signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0048248 and CXCR3 chemokine receptor binding and molecular function this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0051607 and defense response to virus and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity and also this GO :0048248 : CXCR3 chemokine receptor binding, this GO :0005515 : protein binding, this GO :0008009 : chemokine activity, this GO :0048248 : CXCR3 chemokine receptor binding, chemokine (C-X-C motif) ligand 9 |
| Identity: |
7098 |
| Gene: |
CXCL9 |
More about : CXCL9 |
| Long gene name: |
C-X-C motif chemokine ligand 9 |
| Synonyms gene: |
CMK MIG |
| Synonyms gene name: |
monokine induced by gamma interferon chemokine (C-X-C motif) ligand 9 |
| Synonyms: |
SCYB9 Humig crg-10 |
| Locus: |
4q21, 1 |
| Discovery year: |
1996-05-28 |
| GenBank acession: |
X72755 |
| Entrez gene record: |
4283 |
| Pubmed identfication: |
8476424 9730616 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000160889 |