| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
10, 3 kD |
| UniProt number: |
Q9JKC0 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CCL24, Eotaxin-2, C-C Motif Chemokine 24 |
| Short name: |
CCL24, Eotaxin-2, Recombinant Mouse C-C Motif Chemokine 24 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
Eotaxin-2, chemokine (C-C motif) ligand 24, recombinant Mouse C-C Motif Chemokine 24 |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, CCL24 and IDBG-22726 and ENSG00000106178 and 6369, Ccl24 and IDBG-203945 and ENSMUSG00000004814 and 56221, Ckb-6 and MPIF-2 and MPIF2 and SCYA24, Extracellular, chemokine activity, this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007010 and cytoskeleton organization and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008360 and regulation of cell shape and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030838 and positive regulation of actin filament polymerization and biological process this GO :0032855 and positive regulation of Rac GTPase activity and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0048245 and eosinophil chemotaxis and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :2000418 and positive regulation of eosinophil migration and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity, 32408 and IDBG-640099 and ENSBTAG00000026275 and 617258, chemokine (C-C motif) ligand 24 |
| Identity: |
10623 |
| Gene: |
CCL24 |
More about : CCL24 |
| Long gene name: |
C-C motif chemokine ligand 24 |
| Synonyms gene: |
SCYA24 |
| Synonyms gene name: |
member 24 chemokine (C-C motif) ligand 24 , small inducible cytokine subfamily A (Cys-Cys) |
| Synonyms: |
Ckb-6 MPIF-2 eotaxin-2 MPIF2 |
| Synonyms name: |
CK-beta-6 myeloid progenitor inhibitory factor 2 eotaxin-2 |
| Locus: |
7q11, 23 |
| Discovery year: |
1997-11-14 |
| GenBank acession: |
U85768 |
| Entrez gene record: |
6369 |
| Pubmed identfication: |
9104803 9598329 |
| RefSeq identity: |
NM_002991 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000156635 |