Recombinant Mouse C-C motif chemokine 2, CCL2

Contact us
Catalog number: CR09
Price: 1431 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse C-C motif chemokine 2, CCL2
Quantity: 100ug
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse C-C motif Chemokine 2 is produced by our E, coli expression system and the target gene encoding Gln24-Arg96 is expressed
Molecular Weight: 5 kD, 8
UniProt number: P10148
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CCL2, C-C motif chemokine 2
Short name: CCL2, Recombinant Mouse C-C motif chemokine 2
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: chemokine (C-C motif) ligand 2, recombinant Mouse C-C motif chemokine 2
Alternative technique: rec
Alternative to gene target: CCL2 and IDBG-40504 and ENSG00000108691 and 6347, CCL2 and IDBG-630954 and ENSBTAG00000037811 and 281043, CCR2 chemokine receptor binding, Ccl2 and IDBG-204473 and ENSMUSG00000035385 and 20296, Extracellular, GDCF-2 and HC11 and HSMCR30 and MCAF and MCP-1 and MCP1 and SCYA2 and SMC-CF, coupled to cyclic nucleotide second messenger and biological process this GO :0007259 and JAK-STAT cascade and biological process this GO :0007568 and aging and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0008347 and glial cell migration and biological process this GO :0008360 and regulation of cell shape and biological process this GO :0009408 and response to heat and biological process this GO :0009611 and response to wounding and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009617 and response to bacterium and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0010574 and regulation of vascular endothelial growth factor production and biological process this GO :0010759 and positive regulation of macrophage chemotaxis and biological process this GO :0014823 and response to activity and biological process this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0019079 and viral genome replication and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019725 and cellular homeostasis and biological process this GO :0022409 and positive regulation of cell-cell adhesion and biological process this GO :0030139 and endocytic vesicle and cellular component this GO :0030425 and dendrite and cellular component this GO :0030593 and neutrophil chemotaxis and biological process this GO :0030968 and endoplasmic reticulum unfolded protein response and biological process this GO :0031100 and organ regeneration and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0031727 and CCR2 chemokine receptor binding and molecular function this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032570 and response to progesterone and biological process this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0032869 and cellular response to insulin stimulus and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0033552 and response to vitamin B3 and biological process this GO :0034351 and negative regulation of glial cell apoptotic process and biological process this GO :0035684 and helper T cell extravasation and biological process this GO :0035690 and cellular response to drug and biological process this GO :0036006 and cellular response to macrophage colony-stimulating factor stimulus and biological process this GO :0036120 and cellular response to platelet-derived growth factor stimulus and biological process this GO :0042493 and response to drug and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043200 and response to amino acid and biological process this GO :0043204 and perikaryon and cellular component this GO :0043491 and protein kinase B signaling and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0043615 and astrocyte cell migration and biological process this GO :0043679 and axon terminus and cellular component this GO :0044267 and cellular protein metabolic process and biological process this GO :0044299 and C-fiber and cellular component this GO :0044344 and cellular response to fibroblast growth factor stimulus and biological process this GO :0045087 and innate immune response and biological process this GO :0045202 and synapse and cellular component this GO :0045471 and response to ethanol and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0046677 and response to antibiotic and biological process this GO :0048010 and vascular endothelial growth factor receptor signaling pathway and biological process this GO :0048246 and macrophage chemotaxis and biological process this GO :0048247 and lymphocyte chemotaxis and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0050870 and positive regulation of T cell activation and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051770 and positive regulation of nitric-oxide synthase biosynthetic process and biological process this GO :0060135 and maternal process involved in female pregnancy and biological process this GO :0060137 and maternal process involved in parturition and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0070098 and chemokine-mediated signaling pathway and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071300 and cellular response to retinoic acid and biological process this GO :0071318 and cellular response to ATP and biological process this GO :0071346 and cellular response to interferon-gamma and biological process this GO :0071347 and cellular response to interleukin-1 and biological process this GO :0071354 and cellular response to interleukin-6 and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0071402 and cellular response to lipoprotein particle stimulus and biological process this GO :0071403 and cellular response to high density lipoprotein particle stimulus and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071549 and cellular response to dexamethasone stimulus and biological process this GO :0090026 and positive regulation of monocyte chemotaxis and biological process this GO :0090265 and positive regulation of immune complex clearance by monocytes and macrophages and biological process this GO :0090280 and positive regulation of calcium ion import and biological process this GO :2000427 and positive regulation of apoptotic cell clearance and biological process this GO :2000502 and negative regulation of natural killer cell chemotaxis and biological process, this GO :0000165 and MAPK cascade and biological process this GO :0001525 and angiogenesis and biological process this GO :0001664 and G-protein coupled receptor binding and molecular function this GO :0001666 and response to hypoxia and biological process this GO :0001912 and positive regulation of leukocyte mediated cytotoxicity and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0002523 and leukocyte migration involved in inflammatory response and biological process this GO :0002548 and monocyte chemotaxis and biological process this GO :0002687 and positive regulation of leukocyte migration and biological process this GO :0002693 and positive regulation of cellular extravasation and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005791 and rough endoplasmic reticulum and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006959 and humoral immune response and biological process this GO :0006987 and activation of signaling protein activity involved in unfolded protein response and biological process this GO :0007010 and cytoskeleton organization and biological process this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007187 and G-protein coupled receptor signaling pathway, this GO :0001664 : G-protein coupled receptor binding, this GO :0001664 : G-protein coupled receptor binding and also this GO :0004672 : protein kinase activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity and also this GO :0008201 : heparin binding and also this GO :0031727 : CCR2 chemokine receptor binding, this GO :0004672 : protein kinase activity, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0008009 : chemokine activity, this GO :0008201 : heparin binding, this GO :0031727 : CCR2 chemokine receptor binding, chemokine (C-C motif) ligand 2
Identity: 10618
Gene: CCL2 | More about : CCL2
Long gene name: C-C motif chemokine ligand 2
Synonyms gene: SCYA2
Synonyms gene name: homologous to mouse Sig-je) chemokine (C-C motif) ligand 2 , small inducible cytokine A2 (monocyte chemotactic protein 1
Synonyms: MCP1 MCP-1 MCAF SMC-CF GDCF-2 HC11 MGC9434
Synonyms name: homologous to mouse Sig-je monocyte chemoattractant protein-1 monocyte chemotactic and activating factor monocyte secretory protein JE small inducible cytokine subfamily A (Cys-Cys), member 2 , monocyte chemotactic protein 1
Locus: 17q12
Discovery year: 1990-07-05
GenBank acession: BC009716
Entrez gene record: 6347
Pubmed identfication: 2004761
RefSeq identity: NM_002982
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000132887

Related Products :

MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
CR09 Recombinant Mouse C-C motif chemokine 2, CCL2 50 µg 496 € novo mouse
CS16 Recombinant Mouse C-C motif chemokine 2, CCL2 (C-6His) 1 mg 2486 € novo mouse
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
CM78 Recombinant Human C-C Motif Chemokine 2, CCL2, MCP-1 500 µg 1755 € novo human
EKC01054 C-C motif chemokine 2 (CCL2) ELISA kit 1 plate of 96 wells 596 € Biomatik ELISA kits human
AE51757GU-48 ELISA test for Guinea pig C-C motif chemokine 2 (CCL2) 1x plate of 48 wells 402 € abebio human
AE51756HO-48 ELISA test for Horse C-C motif chemokine 2 (CCL2) 1x plate of 48 wells 402 € abebio horse
AE63286SH-48 ELISA test for Sheep C-C motif chemokine 2 (CCL2) 1x plate of 48 wells 402 € abebio sheep
GENTAUR-58bd8d019d265 Guinea pig C-C motif chemokine 2 (CCL2) 100ug 1359 € MBS Recombinant Proteins human
GENTAUR-58bd8d02153b8 Guinea pig C-C motif chemokine 2 (CCL2) 1000ug 1359 € MBS Recombinant Proteins human
GENTAUR-58bd8d02847b2 Guinea pig C-C motif chemokine 2 (CCL2) 100ug 1862 € MBS Recombinant Proteins human
GENTAUR-58bd8d03062fb Guinea pig C-C motif chemokine 2 (CCL2) 1000ug 1862 € MBS Recombinant Proteins human
AE51757GU Guinea pig C-C motif chemokine 2 (CCL2) ELISA Kit 48 wells plate 515 € ab-elisa elisas human
AE51757GU-96 Guinea pig C-C motif chemokine 2 (CCL2) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE51756HO-96 Horse C-C motif chemokine 2 (CCL2) ELISA Kit 1x plate of 96 wells 671 € abebio horse
GENTAUR-58bc51b9776eb Macaca fascicularis C-C motif chemokine 2 (CCL2) 100ug 1304 € MBS Recombinant Proteins human
GENTAUR-58bc51b9c5f38 Macaca fascicularis C-C motif chemokine 2 (CCL2) 1000ug 1304 € MBS Recombinant Proteins human
GENTAUR-58bc51ba23242 Macaca fascicularis C-C motif chemokine 2 (CCL2) 100ug 1812 € MBS Recombinant Proteins human
GENTAUR-58bc51baccb2b Macaca fascicularis C-C motif chemokine 2 (CCL2) 1000ug 1812 € MBS Recombinant Proteins human
GENTAUR-58b99edfde898 Rat C-C motif chemokine 2 (Ccl2) 100ug 1431 € MBS Recombinant Proteins rat