| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Serpin B9 is produced by our Mammalian expression system and the target gene encoding Met1-Pro376 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
4 kD, 43 |
| UniProt number: |
P50453 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
SERPINB9 (C-6His), Serpin B9 |
| Short name: |
SERPINB9 (C-6His), Recombinant Serpin B9 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
clade B (ovalbumin), member 9 (C-6His), sapiens Serpin B9, serpin peptidase inhibitor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CAP-3 and CAP3 and PI-9 and PI9, SERPINB9 and IDBG-56650 and ENSG00000170542 and 5272, SERPINB9 and IDBG-636797 and ENSBTAG00000031267 and 524513, clade B (ovalbumin), cysteine-type endopeptidase inhibitor activity involved in apoptotic process, member 9, nuclei, this GO :0002020 and protease binding and molecular function this GO :0002448 and mast cell mediated immunity and biological process this GO :0004867 and serine-type endopeptidase inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006955 and immune response and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0016020 and membrane and cellular component this GO :0030162 and regulation of proteolysis and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071391 and cellular response to estrogen stimulus and biological process, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0004867 : serine-type endopeptidase inhibitor activity and also this GO :0005515 : protein binding and also this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0004867 : serine-type endopeptidase inhibitor activity, this GO :0005515 : protein binding, this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, serpin peptidase inhibitor |
| Identity: |
8955 |
| Gene: |
SERPINB9 |
More about : SERPINB9 |
| Long gene name: |
serpin family B member 9 |
| Synonyms gene: |
PI9 |
| Synonyms gene name: |
clade B (ovalbumin), clade B (ovalbumin), member 9 , member 9 serpin peptidase inhibitor, serine (or cysteine) proteinase inhibitor |
| Synonyms: |
CAP3 |
| Locus: |
6p25, 2 |
| Discovery year: |
1995-07-21 |
| GenBank acession: |
L40378 |
| Entrez gene record: |
5272 |
| Pubmed identfication: |
8530382 9858835 24172014 |
| Classification: |
Serpin peptidase inhibitors |
| Havana BLAST/BLAT: |
OTTHUMG00000014131 |