Recombinant Human Serpin B9, SERPINB9 (C-6His)

Contact us
Catalog number: CJ32
Price: 2486 €
Supplier: novo
Product name: Recombinant Human Serpin B9, SERPINB9 (C-6His)
Quantity: 1 mg
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Serpin B9 is produced by our Mammalian expression system and the target gene encoding Met1-Pro376 is expressed with a 6His tag at the C-terminus
Molecular Weight: 4 kD, 43
UniProt number: P50453
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SERPINB9 (C-6His), Serpin B9
Short name: SERPINB9 (C-6His), Recombinant Serpin B9
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: clade B (ovalbumin), member 9 (C-6His), sapiens Serpin B9, serpin peptidase inhibitor, recombinant H
Alternative technique: rec
Alternative to gene target: CAP-3 and CAP3 and PI-9 and PI9, SERPINB9 and IDBG-56650 and ENSG00000170542 and 5272, SERPINB9 and IDBG-636797 and ENSBTAG00000031267 and 524513, clade B (ovalbumin), cysteine-type endopeptidase inhibitor activity involved in apoptotic process, member 9, nuclei, this GO :0002020 and protease binding and molecular function this GO :0002448 and mast cell mediated immunity and biological process this GO :0004867 and serine-type endopeptidase inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006955 and immune response and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0016020 and membrane and cellular component this GO :0030162 and regulation of proteolysis and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071391 and cellular response to estrogen stimulus and biological process, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0004867 : serine-type endopeptidase inhibitor activity and also this GO :0005515 : protein binding and also this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0004867 : serine-type endopeptidase inhibitor activity, this GO :0005515 : protein binding, this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, serpin peptidase inhibitor
Identity: 8955
Gene: SERPINB9 | More about : SERPINB9
Long gene name: serpin family B member 9
Synonyms gene: PI9
Synonyms gene name: clade B (ovalbumin), clade B (ovalbumin), member 9 , member 9 serpin peptidase inhibitor, serine (or cysteine) proteinase inhibitor
Synonyms: CAP3
Locus: 6p25, 2
Discovery year: 1995-07-21
GenBank acession: L40378
Entrez gene record: 5272
Pubmed identfication: 8530382 9858835 24172014
Classification: Serpin peptidase inhibitors
Havana BLAST/BLAT: OTTHUMG00000014131

Related Products :

MBS621879 SERPINB9 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 9, Serpin B9, Cytoplasmic Antiproteinase 3, CAP3, CAP-3, Protease Inhibitor 9, PI9, PI-9) 100ug 735 € MBS Polyclonals_1 human
CJ32 Recombinant Human Serpin B9, SERPINB9 (C-6His) 50 µg 303 € novo human
MBS622823 SERPINA10 (Serpin Peptidase Inhibitor Clade A (alpha-1 Antiproteinase Antitrypsin) Member 10, Serpin A10, Protein Z-dependent Protease Inhibitor, Protein Z-dependent Protease Inhibitor Precursor, PZ-dependent Protease Inhibitor, PZI, ZPI) 100ug 735 € MBS Polyclonals_1 human
MBS619680 SERPINB6 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 6, Serpin B6, Cytoplasmic Antiproteinase, CAP, MGC111370, MSTP057, Placental Thrombin Inhibitor, PTI, Protease Inhibitor 6, Protease Inhibitor 6 (Placental Thrombin Inhibitor), PI6, PI-6) Antibody 100ug 735 € MBS Polyclonals_1 human
CB56 Recombinant Human Angiotensinogen, Serpin A8, AGT (C-6His) 50 µg 496 € novo human
CJ01 Recombinant Human Leukocyte Elastase Inhibitor, Serpin B1, SERPINB1 (C-6His) 1 mg 2283 € novo human
C533 Recombinant Human Serpin A1, alpha-1-Antitrypsin (C-6His) 500 µg 1613 € novo human
CA54 Recombinant Human Serpin A10, ZPI (C-6His) 500 µg 1613 € novo human
C534 Recombinant Human Serpin A3, alpha-1-Antichymotrypsin (C-6His) 1 mg 2283 € novo human
C928 Recombinant Human Serpin A4, Kallistatin (C-6His) 1 mg 2283 € novo human
C535 Recombinant Human Serpin A5, Protein C Inhibitor (C-6His) 500 µg 1613 € novo human
C639 Recombinant Human Serpin A6 , Transcortin (C-6His) 50 µg 496 € novo human
C536 Recombinant Human Serpin A7, TBG (C-6His) 50 µg 369 € novo human
CI96 Recombinant Human Serpin B12, SERPINB12 (C-6His) 500 µg 1613 € novo human
CJ63 Recombinant Human Serpin B3, SERPINB3, SCCA1 (C-6His) 1 mg 2486 € novo human
CM24 Recombinant Human Serpin B3, SERPINB3, SCCA1 (N-6His) 50 µg 496 € novo human
CE54 Recombinant Human Serpin B6, Placental Thrombin Inhibitor (N-Trx, 6His) 50 µg 496 € novo human
C537 Recombinant Human Serpin E1, PAI-1 (C-6His) 10 µg 202 € novo human
C538 Recombinant Human Serpin F1, PEDF(C-6His) 50 µg 369 € novo human
C539 Recombinant Human Serpin G1, C1 Inhibitor (C-6His) 50 µg 369 € novo human
C800 Recombinant Human Serpin H1 (C-6His) 1 mg 2283 € novo human
CJ02 Recombinant Human Serpin I2 (C-6His) 500 µg 1613 € novo human
C542 Recombinant Human Serpin Kazal-1 (C-6His) 500 µg 1613 € novo human
C543 Recombinant Human Serpin Kazal-4, SPINK4 (C-6His) 500 µg 1613 € novo human
CJ18 Recombinant Human Serpin Kazal-7, SPINK7, ECG2 (C-6His) 1 mg 2486 € novo human
RP-1395H Recombinant Human SerpinB9 / CAP-3 Protein (His Tag) 50μg 624 € adv human
C685 Recombinant Mouse Alpha-1-antitrypsin 1-1, Serpin A1a (C-6His) 1 mg 2486 € novo mouse
C695 Recombinant Mouse α-1-Antitrypsin 1-3, SERPIN A1b (C-6His) 10 µg 202 € novo human
CD21 Recombinant Mouse Plasminogen Activator Inhibitor 1, PAI-1, SERPIN E1 (C-6His) 1 mg 2486 € novo mouse
C665 Recombinant Mouse Serine Protease Inhibitor A3N, Serpin A3N (C-6His) 1 mg 2486 € novo mouse