Recombinant Human Serpin A10, ZPI (C-6His)

Contact us
Catalog number: CA54
Price: 1613 €
Supplier: novo
Product name: Recombinant Human Serpin A10, ZPI (C-6His)
Quantity: 500 µg
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Serpin A10 is produced by our Mammalian expression system and the target gene encoding Leu22-Leu444 is expressed with a 6His tag at the C-terminus
Molecular Weight: 49, 5 kD
UniProt number: Q9UK55
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM GaCl2,pH7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLLLDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ZPI (C-6His), Serpin A10
Short name: ZPI (C-6His), Recombinant Serpin A10
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ZPI (C-6His), sapiens Serpin A10, recombinant H
Alternative technique: rec
Identity: 15996
Gene: SERPINA10 | More about : SERPINA10
Long gene name: serpin family A member 10
Synonyms gene name: antitrypsin), antitrypsin), clade A (alpha-1 antiproteinase, clade A (alpha-1 antiproteinase, member 10 , member 10 serpin peptidase inhibitor, serine (or cysteine) proteinase inhibitor
Synonyms: PZI ZPI
Locus: 14q32, 13
Discovery year: 2001-06-27
GenBank acession: AF181467
Entrez gene record: 51156
Pubmed identfication: 10460162 9689066 24172014
RefSeq identity: NM_016186
Classification: Serpin peptidase inhibitors
Havana BLAST/BLAT: OTTHUMG00000171345

Related Products :

CA54 Recombinant Human Serpin A10, ZPI (C-6His) 500 µg 1613 € novo human
MBS622823 SERPINA10 (Serpin Peptidase Inhibitor Clade A (alpha-1 Antiproteinase Antitrypsin) Member 10, Serpin A10, Protein Z-dependent Protease Inhibitor, Protein Z-dependent Protease Inhibitor Precursor, PZ-dependent Protease Inhibitor, PZI, ZPI) 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58ba3e380d1ba Alcelaphine herpesvirus 1 Uncharacterized gene A10 protein (A10) 1000ug 2260 € MBS Recombinant Proteins human
GENTAUR-58ba3e391cdd6 Alcelaphine herpesvirus 1 Uncharacterized gene A10 protein (A10) 1000ug 2763 € MBS Recombinant Proteins human
GENTAUR-58ba3ea4e2769 Alcelaphine herpesvirus 1 Uncharacterized gene A10 protein (A10) 1000ug 2260 € MBS Recombinant Proteins human
GENTAUR-58ba3ea58e2d3 Alcelaphine herpesvirus 1 Uncharacterized gene A10 protein (A10) 1000ug 2763 € MBS Recombinant Proteins human
MBS619417 Annexin A10 (ANXA10, annexin A10, ANX14, annexin 14) 100ug 707 € MBS Polyclonals_1 human
abx142216 Anti-Serpin A10 Antibody 100 μl 383 € abbex human
MBS619680 SERPINB6 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 6, Serpin B6, Cytoplasmic Antiproteinase, CAP, MGC111370, MSTP057, Placental Thrombin Inhibitor, PTI, Protease Inhibitor 6, Protease Inhibitor 6 (Placental Thrombin Inhibitor), PI6, PI-6) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS621879 SERPINB9 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 9, Serpin B9, Cytoplasmic Antiproteinase 3, CAP3, CAP-3, Protease Inhibitor 9, PI9, PI-9) 100ug 735 € MBS Polyclonals_1 human
CB56 Recombinant Human Angiotensinogen, Serpin A8, AGT (C-6His) 50 µg 496 € novo human
CJ01 Recombinant Human Leukocyte Elastase Inhibitor, Serpin B1, SERPINB1 (C-6His) 1 mg 2283 € novo human
C533 Recombinant Human Serpin A1, alpha-1-Antitrypsin (C-6His) 500 µg 1613 € novo human
C534 Recombinant Human Serpin A3, alpha-1-Antichymotrypsin (C-6His) 1 mg 2283 € novo human
C928 Recombinant Human Serpin A4, Kallistatin (C-6His) 1 mg 2283 € novo human
C535 Recombinant Human Serpin A5, Protein C Inhibitor (C-6His) 500 µg 1613 € novo human
C639 Recombinant Human Serpin A6 , Transcortin (C-6His) 50 µg 496 € novo human
C536 Recombinant Human Serpin A7, TBG (C-6His) 50 µg 369 € novo human
CI96 Recombinant Human Serpin B12, SERPINB12 (C-6His) 500 µg 1613 € novo human
CJ63 Recombinant Human Serpin B3, SERPINB3, SCCA1 (C-6His) 1 mg 2486 € novo human
CM24 Recombinant Human Serpin B3, SERPINB3, SCCA1 (N-6His) 50 µg 496 € novo human
CE54 Recombinant Human Serpin B6, Placental Thrombin Inhibitor (N-Trx, 6His) 50 µg 496 € novo human
CJ32 Recombinant Human Serpin B9, SERPINB9 (C-6His) 50 µg 303 € novo human
C537 Recombinant Human Serpin E1, PAI-1 (C-6His) 10 µg 202 € novo human
C538 Recombinant Human Serpin F1, PEDF(C-6His) 50 µg 369 € novo human
C539 Recombinant Human Serpin G1, C1 Inhibitor (C-6His) 50 µg 369 € novo human
C800 Recombinant Human Serpin H1 (C-6His) 1 mg 2283 € novo human
CJ02 Recombinant Human Serpin I2 (C-6His) 500 µg 1613 € novo human
C542 Recombinant Human Serpin Kazal-1 (C-6His) 500 µg 1613 € novo human
C543 Recombinant Human Serpin Kazal-4, SPINK4 (C-6His) 500 µg 1613 € novo human