Recombinant Human Serpin Kazal-7, SPINK7, ECG2 (C-6His)

Contact us
Catalog number: CJ18
Price: 2486 €
Supplier: novo
Product name: Recombinant Human Serpin Kazal-7, SPINK7, ECG2 (C-6His)
Quantity: 1 mg
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human SPINK7 is produced by our Mammalian expression system and the target gene encoding Ser20-Cys85 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 8
UniProt number: P58062
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSCVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ECG2 (C-6His), SPINK7, Serpin Kazal-7
Short name: ECG2 (C-6His), SPINK7, Recombinant Serpin Kazal-7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ECG2 (C-6His), SPINK7, sapiens Serpin Kazal-7, recombinant H
Alternative technique: rec
Identity: 24643
Gene: SPINK7 | More about : SPINK7
Long gene name: Kazal type 7 (putative) , serine peptidase inhibitor
Synonyms: ECG2 ECRG2
Synonyms name: esophagus cancer related gene 2
Locus: 5q32
Discovery year: 2006-02-20
Entrez gene record: 84651
Pubmed identfication: 12646258 12970870
RefSeq identity: NM_032566
Classification: Kazal type , Serine peptidase inhibitors
Havana BLAST/BLAT: OTTHUMG00000163522

Related Products :

CJ18 Recombinant Human Serpin Kazal-7, SPINK7, ECG2 (C-6His) 1 mg 2486 € novo human
C542 Recombinant Human Serpin Kazal-1 (C-6His) 500 µg 1613 € novo human
C543 Recombinant Human Serpin Kazal-4, SPINK4 (C-6His) 500 µg 1613 € novo human
MBS622823 SERPINA10 (Serpin Peptidase Inhibitor Clade A (alpha-1 Antiproteinase Antitrypsin) Member 10, Serpin A10, Protein Z-dependent Protease Inhibitor, Protein Z-dependent Protease Inhibitor Precursor, PZ-dependent Protease Inhibitor, PZI, ZPI) 100ug 735 € MBS Polyclonals_1 human
MBS619680 SERPINB6 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 6, Serpin B6, Cytoplasmic Antiproteinase, CAP, MGC111370, MSTP057, Placental Thrombin Inhibitor, PTI, Protease Inhibitor 6, Protease Inhibitor 6 (Placental Thrombin Inhibitor), PI6, PI-6) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS621879 SERPINB9 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 9, Serpin B9, Cytoplasmic Antiproteinase 3, CAP3, CAP-3, Protease Inhibitor 9, PI9, PI-9) 100ug 735 € MBS Polyclonals_1 human
GWB-ATG288 SPINK7, 20-85aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
CB56 Recombinant Human Angiotensinogen, Serpin A8, AGT (C-6His) 50 µg 496 € novo human
CJ01 Recombinant Human Leukocyte Elastase Inhibitor, Serpin B1, SERPINB1 (C-6His) 1 mg 2283 € novo human
C533 Recombinant Human Serpin A1, alpha-1-Antitrypsin (C-6His) 500 µg 1613 € novo human
CA54 Recombinant Human Serpin A10, ZPI (C-6His) 500 µg 1613 € novo human
C534 Recombinant Human Serpin A3, alpha-1-Antichymotrypsin (C-6His) 1 mg 2283 € novo human
C928 Recombinant Human Serpin A4, Kallistatin (C-6His) 1 mg 2283 € novo human
C535 Recombinant Human Serpin A5, Protein C Inhibitor (C-6His) 500 µg 1613 € novo human
C639 Recombinant Human Serpin A6 , Transcortin (C-6His) 50 µg 496 € novo human
C536 Recombinant Human Serpin A7, TBG (C-6His) 50 µg 369 € novo human
CI96 Recombinant Human Serpin B12, SERPINB12 (C-6His) 500 µg 1613 € novo human
CJ63 Recombinant Human Serpin B3, SERPINB3, SCCA1 (C-6His) 1 mg 2486 € novo human
CM24 Recombinant Human Serpin B3, SERPINB3, SCCA1 (N-6His) 50 µg 496 € novo human
CE54 Recombinant Human Serpin B6, Placental Thrombin Inhibitor (N-Trx, 6His) 50 µg 496 € novo human
CJ32 Recombinant Human Serpin B9, SERPINB9 (C-6His) 50 µg 303 € novo human
C537 Recombinant Human Serpin E1, PAI-1 (C-6His) 10 µg 202 € novo human
C538 Recombinant Human Serpin F1, PEDF(C-6His) 50 µg 369 € novo human
C539 Recombinant Human Serpin G1, C1 Inhibitor (C-6His) 50 µg 369 € novo human
C800 Recombinant Human Serpin H1 (C-6His) 1 mg 2283 € novo human
CJ02 Recombinant Human Serpin I2 (C-6His) 500 µg 1613 € novo human
C685 Recombinant Mouse Alpha-1-antitrypsin 1-1, Serpin A1a (C-6His) 1 mg 2486 € novo mouse
C695 Recombinant Mouse α-1-Antitrypsin 1-3, SERPIN A1b (C-6His) 10 µg 202 € novo human
CD21 Recombinant Mouse Plasminogen Activator Inhibitor 1, PAI-1, SERPIN E1 (C-6His) 1 mg 2486 € novo mouse
C665 Recombinant Mouse Serine Protease Inhibitor A3N, Serpin A3N (C-6His) 1 mg 2486 € novo mouse