| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Serpin A1c is produced by our Mammalian expression system and the target gene encoding Glu25-Lys413 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
4 kD, 44 |
| UniProt number: |
Q00896 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHKVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
SERPIN A1b (C-6His), &alpha, -1-Antitrypsin 1-3 |
| Short name: |
SERPIN A1b (C-6His), -1-Antitrypsin 1-3, Recombinant Mouse &alpha |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses |
| Alternative name: |
SERPIN A1b (C-6His), -1-Antitrypsin 1-3, recombinant Mouse &alpha |
| Alternative technique: |
rec |