| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human FKBP25/ is produced by our E, coli expression system and the target gene encoding Met1-Asp224 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
27, 3 kD |
| UniProt number: |
Q00688 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10% glycerol , 2 um filtered solution of 20 mM TrisHCl,1 mM DTT, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His) |
| Short name: |
Recombinant Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His) |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
25kDa (N-6His), sapiens Peptidyl-Prolyl Cis-Trans Isomerase FK506 binding protein 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
25kDa, FKBP-25 and FKBP-3 and FKBP25 and PPIase, FKBP3 and IDBG-5577 and ENSG00000100442 and 2287, FKBP3 and IDBG-633002 and ENSBTAG00000002610 and 515069, Fkbp3 and IDBG-143170 and ENSMUSG00000020949 and 30795, nuclei, poly(A) RNA binding, this GO :0000413 and protein peptidyl-prolyl isomerization and biological process this GO :0003755 and peptidyl-prolyl cis-trans isomerase activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005528 and FK506 binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0006457 and protein folding and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0061077 and chaperone-mediated protein folding and biological process, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0005528 : FK506 binding and also this GO :0044822 : poly(A) RNA binding, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, this GO :0005528 : FK506 binding, this GO :0044822 : poly(A) RNA binding, FK506 binding protein 3 |
| Identity: |
3719 |
| Gene: |
FKBP3 |
More about : FKBP3 |
| Long gene name: |
FK506 binding protein 3 |
| Synonyms gene name: |
25kDa , FK506-binding protein 3 (25kD) FK506 binding protein 3 |
| Synonyms: |
FKBP-25 PPIase |
| Locus: |
14q21, 2 |
| Discovery year: |
1992-09-14 |
| GenBank acession: |
M96256 |
| Entrez gene record: |
2287 |
| Pubmed identfication: |
1374240 1532945 |
| RefSeq identity: |
NM_002013 |
| Classification: |
FKBP prolyl isomerases |
| Havana BLAST/BLAT: |
OTTHUMG00000140267 |