| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A is produced by our E, coli expression system and the target gene encoding Met1-Glu165 is expressed |
| Molecular Weight: |
18 kD |
| UniProt number: |
P62937 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
10%glycerol, pH7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CYPA, Cyclophilin A, Peptidyl-prolyl Cis-trans Isomerase A |
| Short name: |
CYPA, Cyclophilin A, Recombinant Peptidyl-prolyl Cis-trans Isomerase A |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CYPA, Cyclophilin A, sapiens Peptidyl-prolyl Cis-trans Isomerase A, recombinant H |
| Alternative technique: |
rec |
| Identity: |
9253 |
| Gene: |
PPIA |
More about : PPIA |
| Long gene name: |
peptidylprolyl isomerase A |
| Synonyms: |
CYPA |
| Synonyms name: |
cyclophilin A |
| Locus: |
7p13 |
| Discovery year: |
1991-12-06 |
| GenBank acession: |
X52851 |
| Entrez gene record: |
5478 |
| Pubmed identfication: |
1989998 2197089 |
| RefSeq identity: |
NM_021130 |
| Classification: |
Cyclophilin peptidylprolyl isomerases |
| Havana BLAST/BLAT: |
OTTHUMG00000023687 |