Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His)

Contact us
Catalog number: CH60
Price: 1542 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His)
Quantity: 100ug
Other quantities: 10 µg 100€ 50 µg 156€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human FKBP25/ is produced by our E, coli expression system and the target gene encoding Met1-Asp224 is expressed with a 6His tag at the N-terminus
Molecular Weight: 27, 3 kD
UniProt number: Q00688
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% glycerol , 2 um filtered solution of 20 mM TrisHCl,1 mM DTT, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His)
Short name: Recombinant Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: 25kDa (N-6His), sapiens Peptidyl-Prolyl Cis-Trans Isomerase FK506 binding protein 3, recombinant H
Alternative technique: rec
Alternative to gene target: 25kDa, FKBP-25 and FKBP-3 and FKBP25 and PPIase, FKBP3 and IDBG-5577 and ENSG00000100442 and 2287, FKBP3 and IDBG-633002 and ENSBTAG00000002610 and 515069, Fkbp3 and IDBG-143170 and ENSMUSG00000020949 and 30795, nuclei, poly(A) RNA binding, this GO :0000413 and protein peptidyl-prolyl isomerization and biological process this GO :0003755 and peptidyl-prolyl cis-trans isomerase activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005528 and FK506 binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0006457 and protein folding and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0061077 and chaperone-mediated protein folding and biological process, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0005528 : FK506 binding and also this GO :0044822 : poly(A) RNA binding, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, this GO :0005528 : FK506 binding, this GO :0044822 : poly(A) RNA binding, FK506 binding protein 3
Identity: 3719
Gene: FKBP3 | More about : FKBP3
Long gene name: FK506 binding protein 3
Synonyms gene name: 25kDa , FK506-binding protein 3 (25kD) FK506 binding protein 3
Synonyms: FKBP-25 PPIase
Locus: 14q21, 2
Discovery year: 1992-09-14
GenBank acession: M96256
Entrez gene record: 2287
Pubmed identfication: 1374240 1532945
RefSeq identity: NM_002013
Classification: FKBP prolyl isomerases
Havana BLAST/BLAT: OTTHUMG00000140267

Related Products :

CH60 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His) 50 µg 156 € novo human
CE96 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase D, PPID, PPIase D (N, C-6His) 500 µg 1613 € novo human
CC56 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP2, FKBP22, FKBP13 (C-6His) 10 µg 156 € novo human
CG71 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP4, FKBP4 (C-6His) 10 µg 95 € novo human
CA33 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP7, FKBP7 (C-6His) 10 µg 202 € novo human
C253 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase H, PPIH (N-6His) 10 µg 202 € novo human
C291 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase-Like 1, PPIase, PPIL1(N-6His) 500 µg 1613 € novo human
RP-412 Recombinant (E.Coli) Human Peptidyl-Prolyl Cis/Trans Isomerase 5 μg 188 € adi human
CR15 Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A, Cyclophilin A, CYPA 1 mg 1014 € novo human
CR16 Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A, Cyclophilin A, CYPA 500 µg 659 € novo mouse
abx250342 Anti-Human Peptidyl-prolyl cis-trans isomerase FKBP5 ELISA Kit inquire 50 € abbex human
abx250535 Anti-Human Peptidyl-prolyl cis-trans isomerase FKBP8 ELISA Kit 96 tests 659 € abbex human
abx251719 Anti-Human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 ELISA Kit inquire 50 € abbex human
GENTAUR-58bc1dd0dea95 Human Peptidyl-prolyl cis-trans isomerase A (PPIA) 100ug 1536 € MBS Recombinant Proteins human
GENTAUR-58bc1dd13cb00 Human Peptidyl-prolyl cis-trans isomerase A (PPIA) 1000ug 1536 € MBS Recombinant Proteins human
GENTAUR-58bc1dd180c0f Human Peptidyl-prolyl cis-trans isomerase A (PPIA) 100ug 2039 € MBS Recombinant Proteins human
GENTAUR-58bc1dd1c5849 Human Peptidyl-prolyl cis-trans isomerase A (PPIA) 1000ug 2039 € MBS Recombinant Proteins human
GENTAUR-58ba70b227103 Human Peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) 100ug 1940 € MBS Recombinant Proteins human
GENTAUR-58ba70b367a9d Human Peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) 1000ug 1940 € MBS Recombinant Proteins human
GENTAUR-58ba70b3cb2f4 Human Peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) 100ug 2453 € MBS Recombinant Proteins human
GENTAUR-58ba70b4c63f1 Human Peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) 1000ug 2453 € MBS Recombinant Proteins human
GENTAUR-58bafe638091c Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 100ug 1564 € MBS Recombinant Proteins human
GENTAUR-58bafe63eddfd Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 1000ug 1564 € MBS Recombinant Proteins human
GENTAUR-58bafe644de70 Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 100ug 2067 € MBS Recombinant Proteins human
GENTAUR-58bafe64985dc Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 1000ug 2067 € MBS Recombinant Proteins human
GENTAUR-58bb2a84a840c Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 100ug 1564 € MBS Recombinant Proteins human
GENTAUR-58bb2a8512b7f Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 1000ug 1564 € MBS Recombinant Proteins human
GENTAUR-58bb2a855e813 Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 100ug 2067 € MBS Recombinant Proteins human
GENTAUR-58bb2a8591f6c Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 1000ug 2067 € MBS Recombinant Proteins human
GENTAUR-58bc6b7ac037d Acinetobacter sp. Peptidyl-prolyl cis-trans isomerase (rotA) 100ug 1542 € MBS Recombinant Proteins human