| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human PPIase FKBP2 is produced by our Mammalian expression system and the target gene encoding Ala22-Leu142 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
14, 3 kD |
| UniProt number: |
P26885 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTELVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
FKBP13 (C-6His), FKBP22, Peptidyl-Prolyl Cis-Trans Isomerase FKBP2 |
| Short name: |
FKBP13 (C-6His), FKBP22, Recombinant Peptidyl-Prolyl Cis-Trans Isomerase FKBP2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
13kDa, FKBP13 (C-6His), FKBP22, sapiens Peptidyl-Prolyl Cis-Trans Isomerase FK506 binding protein 2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
13kDa, Cytoplasm, FK506 binding, FKBP-13 and PPIase, FKBP2 and IDBG-53311 and ENSG00000173486 and 2286, Fkbp2 and IDBG-137677 and ENSMUSG00000056629 and 14227, this GO :0000413 and protein peptidyl-prolyl isomerization and biological process this GO :0003755 and peptidyl-prolyl cis-trans isomerase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005528 and FK506 binding and molecular function this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0006457 and protein folding and biological process this GO :0061077 and chaperone-mediated protein folding and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity and also this GO :0005515 : protein binding and also this GO :0005528 : FK506 binding, this GO :0005515 : protein binding, this GO :0005528 : FK506 binding, FK506 binding protein 2 |
| Identity: |
18625 |
| Gene: |
FKBP14 |
More about : FKBP14 |
| Long gene name: |
FK506 binding protein 14 |
| Synonyms gene name: |
22 kDa , FK506 binding protein 14 (22 kDa) FK506 binding protein 14 |
| Synonyms: |
FLJ20731 FKBP22 |
| Locus: |
7p14, 3 |
| Discovery year: |
2002-06-05 |
| GenBank acession: |
AK000738 |
| Entrez gene record: |
55033 |
| Pubmed identfication: |
12036304 |
| RefSeq identity: |
NM_017946 |
| Classification: |
FKBP prolyl isomerases EF-hand domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000023442 |
| Locus Specific Databases: |
LRG_454 |